PDB entry 4z6a

View 4z6a on RCSB PDB site
Description: Crystal Structure of a FVIIa-Trypsin Chimera (YT) in Complex with Soluble Tissue Factor
Class: hydrolase
Keywords: trypsin-fold, protein-protein complex, hydrolase
Deposited on 2015-04-04, released 2015-12-30
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-12-30, with a file datestamp of 2015-12-24.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Coagulation factor VII
    Species: Homo sapiens [TaxId:9606]
    Gene: F7
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08709 (0-248)
      • engineered mutation (158-164)
    Domains in SCOPe 2.05: d4z6ah_
  • Chain 'L':
    Compound: Coagulation factor VII
    Species: Homo sapiens [TaxId:9606]
    Gene: F7
    Database cross-references and differences (RAF-indexed):
  • Chain 'T':
    Compound: tissue factor
    Species: Homo sapiens [TaxId:9606]
    Gene: F3
    Database cross-references and differences (RAF-indexed):
  • Heterogens: BGC, FUC, 0Z6, CA, CIT, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4z6aH (H:)
ivggkvcpkgecpwqvlllvngaqlcggtlintiwvvsaahcfdkiknwrnliavlgehd
lsehdgdeqsrrvaqviipstyvpgttnhdiallrlhqpvvltdhvvplclpertfsert
lafvrfslvsgwgqlldrgatalelmvlnvprlmtqdceasypgkiteymfcagysdgsk
dsckgdsggphathyrgtwyltgivswgqgcatvghfgvytrvsqyiewlqklmrseprp
gvllrapfp

  • Chain 'L':
    No sequence available.

  • Chain 'T':
    No sequence available.