PDB entry 4z5r

View 4z5r on RCSB PDB site
Description: Rontalizumab Fab bound to Interferon-a2
Class: Cytokine/Immune System
Keywords: antibody, interferon, Cytokine-Immune System complex
Deposited on 2015-04-02, released 2015-07-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-09-09, with a file datestamp of 2015-09-04.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: anti-IFN-a antibody rontalizumab light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4Z5R (0-End)
    Domains in SCOPe 2.06: d4z5ra1, d4z5ra2
  • Chain 'B':
    Compound: anti-IFN-a antibody rontalizumab heavy chain modules VH and CH1 (Fab)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4Z5R (0-End)
  • Chain 'D':
    Compound: Interferon alpha-2
    Species: Homo sapiens [TaxId:9606]
    Gene: IFNA2, IFNA2A, IFNA2B, IFNA2C
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4z5rd_
  • Chain 'E':
    Compound: Interferon alpha-2
    Species: Homo sapiens [TaxId:9606]
    Gene: IFNA2, IFNA2A, IFNA2B, IFNA2C
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4z5re_
  • Chain 'F':
    Compound: Interferon alpha-2
    Species: Homo sapiens [TaxId:9606]
    Gene: IFNA2, IFNA2A, IFNA2B, IFNA2C
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4z5rf_
  • Chain 'G':
    Compound: Interferon alpha-2
    Species: Homo sapiens [TaxId:9606]
    Gene: IFNA2, IFNA2A, IFNA2B, IFNA2C
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4z5rg_
  • Chain 'H':
    Compound: Interferon alpha-2
    Species: Homo sapiens [TaxId:9606]
    Gene: IFNA2, IFNA2A, IFNA2B, IFNA2C
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4z5rh_
  • Chain 'I':
    Compound: Interferon alpha-2
    Species: Homo sapiens [TaxId:9606]
    Gene: IFNA2, IFNA2A, IFNA2B, IFNA2C
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4z5ri_
  • Chain 'J':
    Compound: anti-IFN-a antibody rontalizumab light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4Z5R (0-End)
    Domains in SCOPe 2.06: d4z5rj1, d4z5rj2
  • Chain 'K':
    Compound: anti-IFN-a antibody rontalizumab heavy chain modules VH and CH1 (Fab)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4Z5R (0-End)
  • Chain 'L':
    Compound: anti-IFN-a antibody rontalizumab light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4Z5R (0-End)
    Domains in SCOPe 2.06: d4z5rl1, d4z5rl2
  • Chain 'M':
    Compound: anti-IFN-a antibody rontalizumab heavy chain modules VH and CH1 (Fab)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4Z5R (0-End)
  • Chain 'N':
    Compound: Interferon alpha-2
    Species: Homo sapiens [TaxId:9606]
    Gene: IFNA2, IFNA2A, IFNA2B, IFNA2C
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4z5rn_
  • Chain 'P':
    Compound: anti-IFN-a antibody rontalizumab light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4Z5R (0-End)
    Domains in SCOPe 2.06: d4z5rp1, d4z5rp2
  • Chain 'Q':
    Compound: anti-IFN-a antibody rontalizumab heavy chain modules VH and CH1 (Fab)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4Z5R (0-End)
  • Chain 'R':
    Compound: anti-IFN-a antibody rontalizumab light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4Z5R (0-End)
    Domains in SCOPe 2.06: d4z5rr1, d4z5rr2
  • Chain 'S':
    Compound: anti-IFN-a antibody rontalizumab heavy chain modules VH and CH1 (Fab)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4Z5R (0-End)
  • Chain 'T':
    Compound: anti-IFN-a antibody rontalizumab light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4Z5R (0-End)
    Domains in SCOPe 2.06: d4z5rt1, d4z5rt2
  • Chain 'U':
    Compound: anti-IFN-a antibody rontalizumab heavy chain modules VH and CH1 (Fab)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4Z5R (0-End)
  • Chain 'V':
    Compound: anti-IFN-a antibody rontalizumab light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4Z5R (0-End)
    Domains in SCOPe 2.06: d4z5rv1, d4z5rv2
  • Chain 'W':
    Compound: anti-IFN-a antibody rontalizumab heavy chain modules VH and CH1 (Fab)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4Z5R (0-End)
  • Chain 'X':
    Compound: Interferon alpha-2
    Species: Homo sapiens [TaxId:9606]
    Gene: IFNA2, IFNA2A, IFNA2B, IFNA2C
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4z5rx_
  • Chain 'Y':
    Compound: anti-IFN-a antibody rontalizumab light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4Z5R (0-End)
    Domains in SCOPe 2.06: d4z5ry_
  • Chain 'Z':
    Compound: anti-IFN-a antibody rontalizumab heavy chain modules VH and CH1 (Fab)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4Z5R (0-End)
  • Heterogens: SO4

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4z5rA (A:)
    diqmtqspsslsasvgdrvtitcrasqsvstssysymhwyqqkpgkapkvlisyasnles
    gvpsrfsgsgsgtdftltisslqpedfatyycqhswgiprtfgqgtkveikrtvaapsvf
    ifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysls
    stltlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4z5rA (A:)
    diqmtqspsslsasvgdrvtitcrasqsvstssysymhwyqqkpgkapkvlisyasnles
    gvpsrfsgsgsgtdftltisslqpedfatyycqhswgiprtfgqgtkveikrtvaapsvf
    ifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysls
    stltlskadyekhkvyacevthqglsspvtksfnrge
    

  • Chain 'B':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4z5rD (D:)
    cdlpqthslgsrrtlmllaqmrkislfsclkdrhdfgfpqeefgnqfqkaetipvlhemi
    qqifnlfstkdssaawdetlldkfytelyqqlndleacviqgvgvtetplmkedsilavr
    kyfqritlylkekkyspcawevvraeimrsfslstnlqeslrske
    

    Sequence, based on observed residues (ATOM records): (download)
    >4z5rD (D:)
    lgsrrtlmllaqmrkislfsclkdrhdfgfpqeefgnqfqkaetipvlhemiqqifnlfs
    tkdssaawdetlldkfytelyqqlndleacviqgvmkedsilavrkyfqritlylkekky
    spcawevvraeimrsfslstn
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4z5rE (E:)
    cdlpqthslgsrrtlmllaqmrkislfsclkdrhdfgfpqeefgnqfqkaetipvlhemi
    qqifnlfstkdssaawdetlldkfytelyqqlndleacviqgvgvtetplmkedsilavr
    kyfqritlylkekkyspcawevvraeimrsfslstnlqeslrske
    

    Sequence, based on observed residues (ATOM records): (download)
    >4z5rE (E:)
    lgsrrtlmllaqmrkislfsclkdrhdfgfpqeefgnqfqkaetipvlhemiqqifnlfs
    tkdssaawdetlldkfytelyqqlndleacviqgvmkedsilavrkyfqritlylkekky
    spcawevvraeimrsfslstn
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4z5rF (F:)
    cdlpqthslgsrrtlmllaqmrkislfsclkdrhdfgfpqeefgnqfqkaetipvlhemi
    qqifnlfstkdssaawdetlldkfytelyqqlndleacviqgvgvtetplmkedsilavr
    kyfqritlylkekkyspcawevvraeimrsfslstnlqeslrske
    

    Sequence, based on observed residues (ATOM records): (download)
    >4z5rF (F:)
    lgsrrtlmllaqmrkislfsclkdrhdfgfpqeefgfqkaetipvlhemiqqifnlfstk
    dssaawdetlldkfytelyqqlndleacviqgvlmkedsilavrkyfqritlylkekkys
    pcawevvraeimrsfslstn
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4z5rG (G:)
    cdlpqthslgsrrtlmllaqmrkislfsclkdrhdfgfpqeefgnqfqkaetipvlhemi
    qqifnlfstkdssaawdetlldkfytelyqqlndleacviqgvgvtetplmkedsilavr
    kyfqritlylkekkyspcawevvraeimrsfslstnlqeslrske
    

    Sequence, based on observed residues (ATOM records): (download)
    >4z5rG (G:)
    lgsrrtlmllaqmrkislfsclkdrhdfgfpqeefgnaetipvlhemiqqifnlfstkds
    saawdetlldkfytelyqqlndleacviqgvgvedsilavrkyfqritlylkekkyspca
    wevvraeimrsfslstn
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4z5rH (H:)
    cdlpqthslgsrrtlmllaqmrkislfsclkdrhdfgfpqeefgnqfqkaetipvlhemi
    qqifnlfstkdssaawdetlldkfytelyqqlndleacviqgvgvtetplmkedsilavr
    kyfqritlylkekkyspcawevvraeimrsfslstnlqeslrske
    

    Sequence, based on observed residues (ATOM records): (download)
    >4z5rH (H:)
    lgsrrtlmllaqmrkislfsclkdrhdfgfpqeefgnqkaetipvlhemiqqifnlfstk
    dssaawdetlldkfytelyqqlndleacviqgvmkedsilavrkyfqritlylkekkysp
    cawevvraeimrsfslstn
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >4z5rI (I:)
    cdlpqthslgsrrtlmllaqmrkislfsclkdrhdfgfpqeefgnqfqkaetipvlhemi
    qqifnlfstkdssaawdetlldkfytelyqqlndleacviqgvgvtetplmkedsilavr
    kyfqritlylkekkyspcawevvraeimrsfslstnlqeslrske
    

    Sequence, based on observed residues (ATOM records): (download)
    >4z5rI (I:)
    lgsrrtlmllaqmrkislfsclkdrhdfgfpqeefgnaetipvlhemiqqifnlfstkds
    saawdetlldkfytelyqqlndleacviqgvmkedsilavrkyfqritlylkekkyspca
    wevvraeimrsfslstn
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >4z5rJ (J:)
    diqmtqspsslsasvgdrvtitcrasqsvstssysymhwyqqkpgkapkvlisyasnles
    gvpsrfsgsgsgtdftltisslqpedfatyycqhswgiprtfgqgtkveikrtvaapsvf
    ifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysls
    stltlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4z5rJ (J:)
    diqmtqspsslsasvgdrvtitcrasqsvstssysymhwyqqkpgkapkvlisyasnles
    gvpsrfsgsgsgtdftltisslqpedfatyycqhswgiprtfgqgtkveikrtvaapsvf
    ifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysls
    stltlskadyekhkvyacevthqglsspvtksfnrge
    

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4z5rL (L:)
    diqmtqspsslsasvgdrvtitcrasqsvstssysymhwyqqkpgkapkvlisyasnles
    gvpsrfsgsgsgtdftltisslqpedfatyycqhswgiprtfgqgtkveikrtvaapsvf
    ifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysls
    stltlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4z5rL (L:)
    diqmtqspsslsasvgdrvtitcrasqsvstssysymhwyqqkpgkapkvlisyasnles
    gvpsrfsgsgsgtdftltisslqpedfatyycqhswgiprtfgqgtkveikrtvaapsvf
    ifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysls
    stltlskadyekhkvyacevthqglsspvtksfnrge
    

  • Chain 'M':
    No sequence available.

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >4z5rN (N:)
    cdlpqthslgsrrtlmllaqmrkislfsclkdrhdfgfpqeefgnqfqkaetipvlhemi
    qqifnlfstkdssaawdetlldkfytelyqqlndleacviqgvgvtetplmkedsilavr
    kyfqritlylkekkyspcawevvraeimrsfslstnlqeslrske
    

    Sequence, based on observed residues (ATOM records): (download)
    >4z5rN (N:)
    lgsrrtlmllaqmrkislfsclkdrhdfgfpqeefgnqfqkaetipvlhemiqqifnlfs
    tkdssaawdetlldkfytelyqqlndleacviqgmkedsilavrkyfqritlylkekkys
    pcawevvraeimrsfslstnlqesl
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >4z5rP (P:)
    diqmtqspsslsasvgdrvtitcrasqsvstssysymhwyqqkpgkapkvlisyasnles
    gvpsrfsgsgsgtdftltisslqpedfatyycqhswgiprtfgqgtkveikrtvaapsvf
    ifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysls
    stltlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4z5rP (P:)
    diqmtqspsslsasvgdrvtitcrasqsvstssysymhwyqqkpgkapkvlisyasnles
    gvpsrfsgsgsgtdftltisslqpedfatyycqhswgiprtfgqgtkveikrtvaapsvf
    ifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysls
    stltlskadyekhkvyacevthqglsspvtksfnrge
    

  • Chain 'Q':
    No sequence available.

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >4z5rR (R:)
    diqmtqspsslsasvgdrvtitcrasqsvstssysymhwyqqkpgkapkvlisyasnles
    gvpsrfsgsgsgtdftltisslqpedfatyycqhswgiprtfgqgtkveikrtvaapsvf
    ifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysls
    stltlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4z5rR (R:)
    diqmtqspsslsasvgdrvtitcrasqsvstssysymhwyqqkpgkapkvlisyasnles
    gvpsrfsgsgsgtdftltisslqpedfatyycqhswgiprtfgqgtkveikrtvaapsvf
    ifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysls
    stltlskadyekhkvyacevthqglsspvtksfnrge
    

  • Chain 'S':
    No sequence available.

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >4z5rT (T:)
    diqmtqspsslsasvgdrvtitcrasqsvstssysymhwyqqkpgkapkvlisyasnles
    gvpsrfsgsgsgtdftltisslqpedfatyycqhswgiprtfgqgtkveikrtvaapsvf
    ifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysls
    stltlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4z5rT (T:)
    diqmtqspsslsasvgdrvtitcrasqsvstssysymhwyqqkpgkapkvlisyasnles
    gvpsrfsgsgsgtdftltisslqpedfatyycqhswgiprtfgqgtkveikrtvaapsvf
    ifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysls
    stltlskadyekhkvyacevthqglsspvtksfnrge
    

  • Chain 'U':
    No sequence available.

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >4z5rV (V:)
    diqmtqspsslsasvgdrvtitcrasqsvstssysymhwyqqkpgkapkvlisyasnles
    gvpsrfsgsgsgtdftltisslqpedfatyycqhswgiprtfgqgtkveikrtvaapsvf
    ifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysls
    stltlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4z5rV (V:)
    diqmtqspsslsasvgdrvtitcrasqsvstssysymhwyqqkpgkapkvlisyasnles
    gvpsrfsgsgsgtdftltisslqpedfatyycqhswgiprtfgqgtkveikrtvaapsvf
    ifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysls
    stltlskadyekhkvyacevthqglsspvtksfnrge
    

  • Chain 'W':
    No sequence available.

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >4z5rX (X:)
    cdlpqthslgsrrtlmllaqmrkislfsclkdrhdfgfpqeefgnqfqkaetipvlhemi
    qqifnlfstkdssaawdetlldkfytelyqqlndleacviqgvgvtetplmkedsilavr
    kyfqritlylkekkyspcawevvraeimrsfslstnlqeslrske
    

    Sequence, based on observed residues (ATOM records): (download)
    >4z5rX (X:)
    lgsrrtlmllaqmrkislfsclkdrhdfgfpqeefqkaetipvlhemiqqifnlfstkds
    saawdetlldkfytelyqqlndleacviqgvmkedsilavrkyfqritlylkekkyspca
    wevvraeimrsfslstn
    

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >4z5rY (Y:)
    diqmtqspsslsasvgdrvtitcrasqsvstssysymhwyqqkpgkapkvlisyasnles
    gvpsrfsgsgsgtdftltisslqpedfatyycqhswgiprtfgqgtkveikrtvaapsvf
    ifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysls
    stltlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4z5rY (Y:)
    diqmtqspsslsasvgdrvtitcrasqsvstssysymhwyqqkpgkapkvlisyasnles
    gvpsrfsgsgsgtdftltisslqpedfatyycqhswgiprtfgqgtkvei
    

  • Chain 'Z':
    No sequence available.