PDB entry 4z50

View 4z50 on RCSB PDB site
Description: Crystal Structure of Multidrug Resistant HIV-1 Protease Clinical Isolate PR20D25N with Tucked Flap
Class: hydrolase
Keywords: HIV-1 Protease, HYDROLASE
Deposited on 2015-04-02, released 2015-10-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: N/A
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q0PQ60
      • engineered mutation (6)
      • engineered mutation (24)
      • engineered mutation (31)
      • engineered mutation (36)
      • engineered mutation (46)
      • engineered mutation (53)
      • engineered mutation (57)
      • engineered mutation (66)
      • engineered mutation (70)
      • engineered mutation (88)
      • engineered mutation (92)
      • engineered mutation (94)
    Domains in SCOPe 2.07: d4z50a_
  • Chain 'B':
    Compound: Protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q0PQ60 (0-98)
      • engineered mutation (6)
      • engineered mutation (24)
      • engineered mutation (31)
      • engineered mutation (36)
      • engineered mutation (46)
      • engineered mutation (53)
      • engineered mutation (57)
      • engineered mutation (66)
      • engineered mutation (70)
      • engineered mutation (88)
      • engineered mutation (92)
      • engineered mutation (94)
    Domains in SCOPe 2.07: d4z50b_
  • Chain 'C':
    Compound: Protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q0PQ60
      • engineered mutation (6)
      • engineered mutation (24)
      • engineered mutation (31)
      • engineered mutation (36)
      • engineered mutation (46)
      • engineered mutation (53)
      • engineered mutation (57)
      • engineered mutation (66)
      • engineered mutation (70)
      • engineered mutation (88)
      • engineered mutation (92)
      • engineered mutation (94)
    Domains in SCOPe 2.07: d4z50c_
  • Chain 'D':
    Compound: Protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q0PQ60 (0-98)
      • engineered mutation (6)
      • engineered mutation (24)
      • engineered mutation (31)
      • engineered mutation (36)
      • engineered mutation (46)
      • engineered mutation (53)
      • engineered mutation (57)
      • engineered mutation (66)
      • engineered mutation (70)
      • engineered mutation (88)
      • engineered mutation (92)
      • engineered mutation (94)
    Domains in SCOPe 2.07: d4z50d_
  • Heterogens: CL, NA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4z50A (A:)
    pqitlwkrpfvtvkvggqlkeallntgadntifedinlpgrwkpkmvggiggflkvreyd
    qvpieiaghkvigtvlvgptpvnvigrdtmtqigatlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4z50B (B:)
    pqitlwkrpfvtvkvggqlkeallntgadntifedinlpgrwkpkmvggiggflkvreyd
    qvpieiaghkvigtvlvgptpvnvigrdtmtqigatlnf
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4z50C (C:)
    pqitlwkrpfvtvkvggqlkeallntgadntifedinlpgrwkpkmvggiggflkvreyd
    qvpieiaghkvigtvlvgptpvnvigrdtmtqigatlnf
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4z50D (D:)
    pqitlwkrpfvtvkvggqlkeallntgadntifedinlpgrwkpkmvggiggflkvreyd
    qvpieiaghkvigtvlvgptpvnvigrdtmtqigatlnf