PDB entry 4z4j

View 4z4j on RCSB PDB site
Description: Crystal Structure of cellobiose 2-epimerase from Caldicellulosiruptor saccharolyticus DSM 8903
Class: isomerase
Keywords: Cellobiose 2-epimerase, latulose, lactose, ISOMERASE
Deposited on 2015-04-02, released 2016-04-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-04-13, with a file datestamp of 2016-04-08.
Experiment type: XRAY
Resolution: 1.54 Å
R-factor: N/A
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cellobiose 2-epimerase
    Species: Caldicellulosiruptor saccharolyticus DSM 8903 [TaxId:351627]
    Gene: Csac_0294
    Database cross-references and differences (RAF-indexed):
    • Uniprot A4XGA6 (12-401)
      • expression tag (10-11)
    Domains in SCOPe 2.07: d4z4ja1, d4z4ja2
  • Heterogens: IPA, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4z4jA (A:)
    smtggqqmgrgsmditrfkedlkahleekiipfwqslkddefggyygymdfnlnidrkaq
    kgcilnsrilwffsacynvlksekckemafhafeflknkfwdkeyeglfwsvshkgvpvd
    vtkhvyvqafgiyglseyyeasgdeealhmakrlfeiletkckrengyteqfernwqeke
    nrflsengviasktmnthlhvlesytnlyrllklddvyealewivrlfvdkiykkgtghf
    kvfcddnwnelikavsyghdieaswlldqaakylkdeklkeeveklalevaqitlkeafd
    gqslinemiedridrskiwwveaetvvgffnayqktkeekyldaaiktwefikehlvdrr
    knsewlwkvnedleavnmpiveqwkcpyhngrmcleiikrvd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4z4jA (A:)
    gsmditrfkedlkahleekiipfwqslkddefggyygymdfnlnidrkaqkgcilnsril
    wffsacynvlksekckemafhafeflknkfwdkeyeglfwsvshkgvpvdvtkhvyvqaf
    giyglseyyeasgdeealhmakrlfeiletkckrengyteqfernwqekenrflsengvi
    asktmnthlhvlesytnlyrllklddvyealewivrlfvdkiykkgtghfkvfcddnwne
    likavsyghdieaswlldqaakylkdeklkeeveklalevaqitlkeafdgqslinemie
    dridrskiwwveaetvvgffnayqktkeekyldaaiktwefikehlvdrrknsewlwkvn
    edleavnmpiveqwkcpyhngrmcleiikrvd