PDB entry 4z42

View 4z42 on RCSB PDB site
Description: Crystal structure of urease from Yersinia enterocolitica
Class: hydrolase
Keywords: hydrolase, urease, urea degradation, nitrogen metabolism
Deposited on 2015-04-01, released 2016-04-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-11-21, with a file datestamp of 2018-11-16.
Experiment type: XRAY
Resolution: 3.01 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Urease subunit gamma
    Species: Yersinia enterocolitica W22703 [TaxId:913028]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4z42a_
  • Chain 'B':
    Compound: urease subunit beta
    Species: Yersinia enterocolitica W22703 [TaxId:913028]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4z42b_
  • Chain 'C':
    Compound: urease subunit alpha
    Species: Yersinia enterocolitica W22703 [TaxId:913028]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Urease subunit gamma
    Species: Yersinia enterocolitica W22703 [TaxId:913028]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4z42d_
  • Chain 'E':
    Compound: urease subunit beta
    Species: Yersinia enterocolitica W22703 [TaxId:913028]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4z42e_
  • Chain 'F':
    Compound: urease subunit alpha
    Species: Yersinia enterocolitica W22703 [TaxId:913028]
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: Urease subunit gamma
    Species: Yersinia enterocolitica W22703 [TaxId:913028]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4z42g_
  • Chain 'H':
    Compound: urease subunit beta
    Species: Yersinia enterocolitica W22703 [TaxId:913028]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4z42h_
  • Chain 'I':
    Compound: urease subunit alpha
    Species: Yersinia enterocolitica W22703 [TaxId:913028]
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: Urease subunit gamma
    Species: Yersinia enterocolitica W22703 [TaxId:913028]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4z42j_
  • Chain 'K':
    Compound: urease subunit beta
    Species: Yersinia enterocolitica W22703 [TaxId:913028]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4z42k_
  • Chain 'L':
    Compound: urease subunit alpha
    Species: Yersinia enterocolitica W22703 [TaxId:913028]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4z42A (A:)
    mqltpreveklmiytlsdvafkrkarglklnypeavsiitvtamegardgksvedvmkea
    skvltkddvmdgvadlipnvqveaiftdgsrlvtvhdpik
    

    Sequence, based on observed residues (ATOM records): (download)
    >4z42A (A:)
    mqltpreveklmiytlsdvafkrkarglklnypeavsiitvtamegardgksvedvmkea
    skvltkddvmdgvadlipnvqveaiftdgsrlvtvhdpi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4z42B (B:)
    mstktnstkatsektdslktnsgtkssagyseqntplggciladtpitfnenkpvtkvkv
    rntgdrpiqvgshfhffevnralefdraaaygkrlnissttairfepgdetevplipfgg
    kqtlygfnnlvdgwtgegvvpnserpdkleairraaergfkssk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4z42B (B:)
    ntplggciladtpitfnenkpvtkvkvrntgdrpiqvgshfhffevnralefdraaaygk
    rlnissttairfepgdetevplipfggkqtlygfnnlvdgwtgegvvpnserpd
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4z42D (D:)
    mqltpreveklmiytlsdvafkrkarglklnypeavsiitvtamegardgksvedvmkea
    skvltkddvmdgvadlipnvqveaiftdgsrlvtvhdpik
    

    Sequence, based on observed residues (ATOM records): (download)
    >4z42D (D:)
    mqltpreveklmiytlsdvafkrkarglklnypeavsiitvtamegardgksvedvmkea
    skvltkddvmdgvadlipnvqveaiftdgsrlvtvhdpi
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4z42E (E:)
    mstktnstkatsektdslktnsgtkssagyseqntplggciladtpitfnenkpvtkvkv
    rntgdrpiqvgshfhffevnralefdraaaygkrlnissttairfepgdetevplipfgg
    kqtlygfnnlvdgwtgegvvpnserpdkleairraaergfkssk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4z42E (E:)
    ntplggciladtpitfnenkpvtkvkvrntgdrpiqvgshfhffevnralefdraaaygk
    rlnissttairfepgdetevplipfggkqtlygfnnlvdgwtgegvvpnserpd
    

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4z42G (G:)
    mqltpreveklmiytlsdvafkrkarglklnypeavsiitvtamegardgksvedvmkea
    skvltkddvmdgvadlipnvqveaiftdgsrlvtvhdpik
    

    Sequence, based on observed residues (ATOM records): (download)
    >4z42G (G:)
    mqltpreveklmiytlsdvafkrkarglklnypeavsiitvtamegardgksvedvmkea
    skvltkddvmdgvadlipnvqveaiftdgsrlvtvhdpi
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4z42H (H:)
    mstktnstkatsektdslktnsgtkssagyseqntplggciladtpitfnenkpvtkvkv
    rntgdrpiqvgshfhffevnralefdraaaygkrlnissttairfepgdetevplipfgg
    kqtlygfnnlvdgwtgegvvpnserpdkleairraaergfkssk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4z42H (H:)
    ntplggciladtpitfnenkpvtkvkvrntgdrpiqvgshfhffevnralefdraaaygk
    rlnissttairfepgdetevplipfggkqtlygfnnlvdgwtgegvvpnserpd
    

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >4z42J (J:)
    mqltpreveklmiytlsdvafkrkarglklnypeavsiitvtamegardgksvedvmkea
    skvltkddvmdgvadlipnvqveaiftdgsrlvtvhdpik
    

    Sequence, based on observed residues (ATOM records): (download)
    >4z42J (J:)
    mqltpreveklmiytlsdvafkrkarglklnypeavsiitvtamegardgksvedvmkea
    skvltkddvmdgvadlipnvqveaiftdgsrlvtvhdpi
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >4z42K (K:)
    mstktnstkatsektdslktnsgtkssagyseqntplggciladtpitfnenkpvtkvkv
    rntgdrpiqvgshfhffevnralefdraaaygkrlnissttairfepgdetevplipfgg
    kqtlygfnnlvdgwtgegvvpnserpdkleairraaergfkssk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4z42K (K:)
    ntplggciladtpitfnenkpvtkvkvrntgdrpiqvgshfhffevnralefdraaaygk
    rlnissttairfepgdetevplipfggkqtlygfnnlvdgwtgegvvpnserpd
    

  • Chain 'L':
    No sequence available.