PDB entry 4z3l

View 4z3l on RCSB PDB site
Description: crystal structure of birch pollen allergen bet v 1 mutant g26l, d69i, p90l, k97i
Class: allergen
Keywords: Allergen, Fold Stability
Deposited on 2015-03-31, released 2015-11-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-11-25, with a file datestamp of 2015-11-20.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: major pollen allergen bet v 1-a
    Species: Betula pendula [TaxId:3505]
    Gene: BETVIA, BETVI
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15494 (0-158)
      • engineered mutation (25)
      • engineered mutation (68)
      • engineered mutation (89)
      • engineered mutation (96)
    Domains in SCOPe 2.06: d4z3la_
  • Chain 'B':
    Compound: major pollen allergen bet v 1-a
    Species: Betula pendula [TaxId:3505]
    Gene: BETVIA, BETVI
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15494 (0-158)
      • engineered mutation (25)
      • engineered mutation (68)
      • engineered mutation (89)
      • engineered mutation (96)
    Domains in SCOPe 2.06: d4z3lb_
  • Chain 'C':
    Compound: major pollen allergen bet v 1-a
    Species: Betula pendula [TaxId:3505]
    Gene: BETVIA, BETVI
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15494 (0-158)
      • engineered mutation (25)
      • engineered mutation (68)
      • engineered mutation (89)
      • engineered mutation (96)
    Domains in SCOPe 2.06: d4z3lc_
  • Chain 'D':
    Compound: major pollen allergen bet v 1-a
    Species: Betula pendula [TaxId:3505]
    Gene: BETVIA, BETVI
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15494 (0-158)
      • engineered mutation (25)
      • engineered mutation (68)
      • engineered mutation (89)
      • engineered mutation (96)
    Domains in SCOPe 2.06: d4z3ld_
  • Chain 'E':
    Compound: major pollen allergen bet v 1-a
    Species: Betula pendula [TaxId:3505]
    Gene: BETVIA, BETVI
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15494 (0-158)
      • engineered mutation (25)
      • engineered mutation (68)
      • engineered mutation (89)
      • engineered mutation (96)
    Domains in SCOPe 2.06: d4z3le_
  • Chain 'F':
    Compound: major pollen allergen bet v 1-a
    Species: Betula pendula [TaxId:3505]
    Gene: BETVIA, BETVI
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15494 (0-158)
      • engineered mutation (25)
      • engineered mutation (68)
      • engineered mutation (89)
      • engineered mutation (96)
    Domains in SCOPe 2.06: d4z3lf_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4z3lA (A:)
    gvfnyetettsvipaarlfkafildldnlfpkvapqaissveniegnggpgtikkisfpe
    gfpfkyvkirvdevdhtnfkynysvieggligdtleiisneikivatpdggsilkisnky
    htkgdhevkaeqvkaskemgetllravesyllahsdayn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4z3lB (B:)
    gvfnyetettsvipaarlfkafildldnlfpkvapqaissveniegnggpgtikkisfpe
    gfpfkyvkirvdevdhtnfkynysvieggligdtleiisneikivatpdggsilkisnky
    htkgdhevkaeqvkaskemgetllravesyllahsdayn
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4z3lC (C:)
    gvfnyetettsvipaarlfkafildldnlfpkvapqaissveniegnggpgtikkisfpe
    gfpfkyvkirvdevdhtnfkynysvieggligdtleiisneikivatpdggsilkisnky
    htkgdhevkaeqvkaskemgetllravesyllahsdayn
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4z3lD (D:)
    gvfnyetettsvipaarlfkafildldnlfpkvapqaissveniegnggpgtikkisfpe
    gfpfkyvkirvdevdhtnfkynysvieggligdtleiisneikivatpdggsilkisnky
    htkgdhevkaeqvkaskemgetllravesyllahsdayn
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4z3lE (E:)
    gvfnyetettsvipaarlfkafildldnlfpkvapqaissveniegnggpgtikkisfpe
    gfpfkyvkirvdevdhtnfkynysvieggligdtleiisneikivatpdggsilkisnky
    htkgdhevkaeqvkaskemgetllravesyllahsdayn
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4z3lF (F:)
    gvfnyetettsvipaarlfkafildldnlfpkvapqaissveniegnggpgtikkisfpe
    gfpfkyvkirvdevdhtnfkynysvieggligdtleiisneikivatpdggsilkisnky
    htkgdhevkaeqvkaskemgetllravesyllahsdayn