PDB entry 4z3k

View 4z3k on RCSB PDB site
Description: Human sepiapterin reductase in complex with the cofactor NADP+ and the trypthophan metabolite xanthurenic acid
Class: oxidoreductase
Keywords: sepiapterin-reductase, xanthurenic acid, inhibitor, tryptophan-metabolite, oxidoreductase
Deposited on 2015-03-31, released 2015-11-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-07-20, with a file datestamp of 2016-07-15.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sepiapterin reductase
    Species: Homo sapiens [TaxId:9606]
    Gene: SPR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4z3ka_
  • Chain 'B':
    Compound: sepiapterin reductase
    Species: Homo sapiens [TaxId:9606]
    Gene: SPR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4z3kb_
  • Chain 'C':
    Compound: sepiapterin reductase
    Species: Homo sapiens [TaxId:9606]
    Gene: SPR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4z3kc_
  • Chain 'D':
    Compound: sepiapterin reductase
    Species: Homo sapiens [TaxId:9606]
    Gene: SPR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4z3kd_
  • Heterogens: NAP, 4KL, SO4, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4z3kA (A:)
    mhhhhhhenlyfqgmegglgravclltgasrgfgrtlapllasllspgsvlvlsarndea
    lrqleaelgaersglrvvrvpadlgaeaglqqllgalrelprpkglqrlllinnagslgd
    vskgfvdlsdstqvnnywalnltsmlcltssvlkafpdspglnrtvvnisslcalqpfkg
    walycagkaardmlfqvlaleepnvrvlnyapgpldtdmqqlaretsvdpdmrkglqelk
    akgklvdckvsaqkllsllekdefksgahvdfydk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4z3kA (A:)
    glgravclltgasrgfgrtlapllasllspgsvlvlsarndealrqleaelgaersglrv
    vrvpadlgaeaglqqllgalrelprpkglqrlllinnagslgdvskgfvdlsdstqvnny
    walnltsmlcltssvlkafpdspglnrtvvnisslcalqpfkgwalycagkaardmlfqv
    laleepnvrvlnyapgpldtdmqqlaretsvdpdmrkglqelkakgklvdckvsaqklls
    llekdefksgahvdfyd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4z3kB (B:)
    mhhhhhhenlyfqgmegglgravclltgasrgfgrtlapllasllspgsvlvlsarndea
    lrqleaelgaersglrvvrvpadlgaeaglqqllgalrelprpkglqrlllinnagslgd
    vskgfvdlsdstqvnnywalnltsmlcltssvlkafpdspglnrtvvnisslcalqpfkg
    walycagkaardmlfqvlaleepnvrvlnyapgpldtdmqqlaretsvdpdmrkglqelk
    akgklvdckvsaqkllsllekdefksgahvdfydk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4z3kB (B:)
    glgravclltgasrgfgrtlapllasllspgsvlvlsarndealrqleaelgaersglrv
    vrvpadlgaeaglqqllgalrelprpkglqrlllinnagslgdvskgfvdlsdstqvnny
    walnltsmlcltssvlkafpdspglnrtvvnisslcalqpfkgwalycagkaardmlfqv
    laleepnvrvlnyapgpldtdmqqlaretsvdpdmrkglqelkakgklvdckvsaqklls
    llekdefksgahvdfyd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4z3kC (C:)
    mhhhhhhenlyfqgmegglgravclltgasrgfgrtlapllasllspgsvlvlsarndea
    lrqleaelgaersglrvvrvpadlgaeaglqqllgalrelprpkglqrlllinnagslgd
    vskgfvdlsdstqvnnywalnltsmlcltssvlkafpdspglnrtvvnisslcalqpfkg
    walycagkaardmlfqvlaleepnvrvlnyapgpldtdmqqlaretsvdpdmrkglqelk
    akgklvdckvsaqkllsllekdefksgahvdfydk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4z3kC (C:)
    glgravclltgasrgfgrtlapllasllspgsvlvlsarndealrqleaelgaersglrv
    vrvpadlgaeaglqqllgalrelprpkglqrlllinnagslgdvskgfvdlsdstqvnny
    walnltsmlcltssvlkafpdspglnrtvvnisslcalqpfkgwalycagkaardmlfqv
    laleepnvrvlnyapgpldtdmqqlaretsvdpdmrkglqelkakgklvdckvsaqklls
    llekdefksgahvdfyd
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4z3kD (D:)
    mhhhhhhenlyfqgmegglgravclltgasrgfgrtlapllasllspgsvlvlsarndea
    lrqleaelgaersglrvvrvpadlgaeaglqqllgalrelprpkglqrlllinnagslgd
    vskgfvdlsdstqvnnywalnltsmlcltssvlkafpdspglnrtvvnisslcalqpfkg
    walycagkaardmlfqvlaleepnvrvlnyapgpldtdmqqlaretsvdpdmrkglqelk
    akgklvdckvsaqkllsllekdefksgahvdfydk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4z3kD (D:)
    glgravclltgasrgfgrtlapllasllspgsvlvlsarndealrqleaelgaersglrv
    vrvpadlgaeaglqqllgalrelprpkglqrlllinnagslgdvskgfvdlsdstqvnny
    walnltsmlcltssvlkafpdspglnrtvvnisslcalqpfkgwalycagkaardmlfqv
    laleepnvrvlnyapgpldtdmqqlaretsvdpdmrkglqelkakgklvdckvsaqklls
    llekdefksgahvdfyd