PDB entry 4z2s

View 4z2s on RCSB PDB site
Description: The crystal structure of Sclerotium Rolfsii lectin variant 2 (SSR2) in complex with N-acetyl-glucosamine
Class: sugar binding protein
Keywords: Lectin, sugar binding protein, carbohydrate- binding specificity, sugar binding protein
Deposited on 2015-03-30, released 2015-07-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-07-01, with a file datestamp of 2015-06-26.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sclerotium Rolfsii lectin variant
    Species: Athelia rolfsii [TaxId:39291]
    Database cross-references and differences (RAF-indexed):
    • PDB 4Z2S (0-141)
    Domains in SCOPe 2.07: d4z2sa_
  • Chain 'B':
    Compound: Sclerotium Rolfsii lectin variant
    Species: Athelia rolfsii [TaxId:39291]
    Database cross-references and differences (RAF-indexed):
    • PDB 4Z2S (0-141)
    Domains in SCOPe 2.07: d4z2sb_
  • Heterogens: TRS, NDG, NAG, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4z2sA (A:)
    mvykitvrvyqtnpdaffhpvektvwkyanggtwsitddqhvltmggsgtsgtlrfhadn
    gesftatfgvhnykrwcdivtnlaadetgmvinqqyysqknreearerqlsnyqvknakg
    rnfqivyteaegndlhanliig
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4z2sB (B:)
    mvykitvrvyqtnpdaffhpvektvwkyanggtwsitddqhvltmggsgtsgtlrfhadn
    gesftatfgvhnykrwcdivtnlaadetgmvinqqyysqknreearerqlsnyqvknakg
    rnfqivyteaegndlhanliig