PDB entry 4z2q

View 4z2q on RCSB PDB site
Description: The crystal structure of Sclerotium Rolfsii lectin variant 1 (SSR1) in complex with N-acetyl-glucosamine
Class: sugar binding protein
Keywords: Lectin, sugar binding protein, carbohydrate- binding specificity
Deposited on 2015-03-30, released 2015-07-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-07-01, with a file datestamp of 2015-06-26.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lectin
    Species: Athelia rolfsii [TaxId:39291]
    Gene: L1
    Database cross-references and differences (RAF-indexed):
    • PDB 4Z2Q (0-140)
    Domains in SCOPe 2.07: d4z2qa_
  • Chain 'B':
    Compound: lectin
    Species: Athelia rolfsii [TaxId:39291]
    Gene: L1
    Database cross-references and differences (RAF-indexed):
    • PDB 4Z2Q (0-140)
    Domains in SCOPe 2.07: d4z2qb_
  • Heterogens: TRS, NDG, NAG, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4z2qA (A:)
    tykitvrvyqtnpdaffhpvektvwkyanggtwtitddqhvltmggsgtsgtlrfhadng
    esftatfgvhnykrwcdivtnlaadetgmvinqqyysqknreearerqlsnyqvknakgr
    nfqivyteaegndlhanliig
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4z2qB (B:)
    tykitvrvyqtnpdaffhpvektvwkyanggtwtitddqhvltmggsgtsgtlrfhadng
    esftatfgvhnykrwcdivtnlaadetgmvinqqyysqknreearerqlsnyqvknakgr
    nfqivyteaegndlhanliig