PDB entry 4z2p

View 4z2p on RCSB PDB site
Description: Crystal structure of short hoefavidin-hoef-peptide(L9F) complex
Class: biotin binding protein
Keywords: protein binding, high affinity system, bacterial avidins, biotin binding protein
Deposited on 2015-03-30, released 2015-07-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-08-05, with a file datestamp of 2015-07-31.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Avidin family
    Species: Hoeflea phototrophica DFL-43 [TaxId:411684]
    Gene: HPDFL43_17171
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4z2pa_
  • Chain 'B':
    Compound: Avidin family
    Species: Hoeflea phototrophica DFL-43 [TaxId:411684]
    Gene: HPDFL43_17171
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4z2pb_
  • Chain 'C':
    Compound: Hoef-peptide (L9F)
    Species: Hoeflea phototrophica DFL-43 [TaxId:411684]
    Database cross-references and differences (RAF-indexed):
    • PDB 4Z2P (Start-11)
  • Chain 'P':
    Compound: Hoef-peptide (L9F)
    Species: Hoeflea phototrophica DFL-43 [TaxId:411684]
    Database cross-references and differences (RAF-indexed):
    • PDB 4Z2P (Start-11)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4z2pA (A:)
    faddhamspdmkllagasnwvnqsgsvaqfvftpsptqpqtyevsgnyinnaqgtgckgt
    pyplsgayysgnqiisfsvvwsnasancqsatgwtgyfdfsgsqavlktdwnlafysgst
    paiqqgqddfmqsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4z2pA (A:)
    spdmkllagasnwvnqsgsvaqfvftpsptqpqtyevsgnyinnaqgtgckgtpyplsga
    yysgnqiisfsvvwsnasancqsatgwtgyfdfsgsqavlktdwnlafysgstpaiqqgq
    ddfmqsv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4z2pB (B:)
    faddhamspdmkllagasnwvnqsgsvaqfvftpsptqpqtyevsgnyinnaqgtgckgt
    pyplsgayysgnqiisfsvvwsnasancqsatgwtgyfdfsgsqavlktdwnlafysgst
    paiqqgqddfmqsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4z2pB (B:)
    spdmkllagasnwvnqsgsvaqfvftpsptqpqtyevsgnyinnaqgtgckgtpyplsga
    yysgnqiisfsvvwsnasancqsatgwtgyfdfsgsqavlktdwnlafysgstpaiqqgq
    ddfmqs
    

  • Chain 'C':
    No sequence available.

  • Chain 'P':
    No sequence available.