PDB entry 4z2o

View 4z2o on RCSB PDB site
Description: High resolution crystal structure of short hoefavidin-hoef-peptide complex
Class: biotin binding protein
Keywords: protein binding, high affinity system, bacterial avidins, biotin, biotin binding protein
Deposited on 2015-03-30, released 2015-07-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-06, with a file datestamp of 2017-12-01.
Experiment type: XRAY
Resolution: 1.17 Å
R-factor: N/A
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Avidin family
    Species: Hoeflea phototrophica DFL-43 [TaxId:411684]
    Gene: HPDFL43_17171
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4z2oa_
  • Chain 'P':
    Compound: Hoef-peptide
    Species: Hoeflea phototrophica DFL-43 [TaxId:411684]
    Database cross-references and differences (RAF-indexed):
    • PDB 4Z2O (Start-11)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >4z2oA (A:)
faddhamspdmkllagasnwvnqsgsvaqfvftpsptqpqtyevsgnyinnaqgtgckgt
pyplsgayysgnqiisfsvvwsnasancqsatgwtgyfdfsgsqavlktdwnlafysgst
paiqqgqddfmqsv

    Sequence, based on observed residues (ATOM records): (download) 
    >4z2oA (A:)
spdmkllagasnwvnqsgsvaqfvftpsptqpqtyevsgnyinnaqgtgckgtpyplsga
yysgnqiisfsvvwsnasancqsatgwtgyfdfsgsqavlktdwnlafysgstpaiqqgq
ddfmqsv

  • Chain 'P':
    No sequence available.