PDB entry 4z2a

View 4z2a on RCSB PDB site
Description: Crystal structure of unglycosylated apo human furin @1.89A
Class: hydrolase
Keywords: unglycosylated, apo, serine proteinase, HYDROLASE
Deposited on 2015-03-29, released 2016-05-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-05-04, with a file datestamp of 2016-04-29.
Experiment type: XRAY
Resolution: 1.89 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Furin
    Species: Homo sapiens [TaxId:9606]
    Gene: FURIN, FUR, PACE, PCSK3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09958 (0-464)
      • engineered mutation (277)
      • engineered mutation (330)
    Domains in SCOPe 2.07: d4z2aa1, d4z2aa2
  • Heterogens: CA, PO4, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4z2aA (A:)
    yqeptdpkfpqqwylsgvtqrdlnvkaawaqgytghgivvsilddgieknhpdlagnydp
    gasfdvndqdpdpqprytqmndnrhgtrcagevaavanngvcgvgvaynariggvrmldg
    evtdavearslglnpnhihiysaswgpeddgktvdgparlaeeaffrgvsqgrgglgsif
    vwasgnggrehdscncdgytnsiytlsissatqfgnvpwyseacsstlattyssgnqnek
    qivttdlrqkcteshtgtsasaplaagiialtleankdltwrdmqhlvvqtskpahlnan
    dwatngvgrkvshsygyglldagamvalaqdwttvapqrkciidiltepkdigkrlevrk
    tvtaclgepnhitrlehaqarltlsynrrgdlaihlvspmgtrstllaarphdysadgfn
    dwafmtthswdedpsgewvleientseannygtltkftlvlygta