PDB entry 4z27

View 4z27 on RCSB PDB site
Description: Crystal structure of apo short hoefavidin
Class: Biotin-binding protein
Keywords: high affinity system, bacterial avidins, biotin-binding protein
Deposited on 2015-03-29, released 2015-08-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-08-05, with a file datestamp of 2015-07-31.
Experiment type: XRAY
Resolution: 1.34 Å
R-factor: N/A
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Avidin family
    Species: Hoeflea phototrophica DFL-43 [TaxId:411684]
    Gene: HPDFL43_17171
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4z27a_
  • Chain 'B':
    Compound: Avidin family
    Species: Hoeflea phototrophica DFL-43 [TaxId:411684]
    Gene: HPDFL43_17171
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4z27b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4z27A (A:)
    faddhamspdmkllagasnwvnqsgsvaqfvftpsptqpqtyevsgnyinnaqgtgckgt
    pyplsgayysgnqiisfsvvwsnasancqsatgwtgyfdfsgsqavlktdwnlafysgst
    paiqqgqddfmqsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4z27A (A:)
    dmkllagasnwvnqsgsvaqfvftpsptqpqtyevsgnyinnaqgtgckgtpyplsgayy
    sgnqiisfsvvwsnasancqsatgwtgyfdfsgsqavlktdwnlafysgstpaiqqgqdd
    fmqs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4z27B (B:)
    faddhamspdmkllagasnwvnqsgsvaqfvftpsptqpqtyevsgnyinnaqgtgckgt
    pyplsgayysgnqiisfsvvwsnasancqsatgwtgyfdfsgsqavlktdwnlafysgst
    paiqqgqddfmqsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4z27B (B:)
    spdmkllagasnwvnqsgsvaqfvftpsptqpqtyevsgnyinnaqgtgckgtpyplsga
    yysgnqiisfsvvwsnasancqsatgwtgyfdfsgsqavlktdwnlafysgstpaiqqgq
    ddfmqsv