PDB entry 4z1q

View 4z1q on RCSB PDB site
Description: Crystal structure of the first bromodomain of human BRD4 bound to benzotriazolo-diazepine scaffold
Class: transcription
Keywords: bromodomain, Transcription
Deposited on 2015-03-27, released 2015-04-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-04-08, with a file datestamp of 2015-04-03.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bromodomain-containing protein 4
    Species: Homo sapiens [TaxId:9606]
    Gene: BRD4, HUNK1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4z1qa_
  • Chain 'B':
    Compound: Bromodomain-containing protein 4
    Species: Homo sapiens [TaxId:9606]
    Gene: BRD4, HUNK1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O60885 (1-126)
      • expression tag (0)
  • Heterogens: 558, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >4z1qA (A:)
gstnppppetsnpnkpkrqtnqlqyllrvvlktlwkhqfawpfqqpvdavklnlpdyyki
iktpmdmgtikkrlennyywnaqeciqdfntmftncyiynkpgddivlmaealeklflqk
inelpte

    Sequence, based on observed residues (ATOM records): (download) 
    >4z1qA (A:)
tnppppetsnpnkpkrqtnqlqyllrvvlktlwkhqfawpfqqpvdavklnlpdyykiik
tpmdmgtikkrlennyywnaqeciqdfntmftncyiynkpgddivlmaealeklflqkin
elpt

  • Chain 'B':
    No sequence available.