PDB entry 4z0t

View 4z0t on RCSB PDB site
Description: Crystal Structure of a putative oxoacyl-(acyl carrier protein) reductase from Brucella ovis
Class: oxidoreductase
Keywords: Oxidoreductase, short-chain dehydrogenase/reductase family, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, SSGCID
Deposited on 2015-03-26, released 2015-07-01
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-07-01, with a file datestamp of 2015-06-26.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Oxidoreductase, short-chain dehydrogenase/reductase family
    Species: Brucella ovis [TaxId:444178]
    Gene: BOV_0452
    Database cross-references and differences (RAF-indexed):
    • Uniprot A5VP18 (Start-253)
      • conflict (229)
    Domains in SCOPe 2.05: d4z0ta_
  • Heterogens: EDO, BR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4z0tA (A:)
    mahhhhhhmnidltgrlalvtgasrgigyflslelakrgahviavartvggleelddeir
    klgssatlvplditdmealdrlggtiherwgkldilvanagilgtispighveaktfekv
    mninvtsvwrlirsvdpllrasdagraimlssgvahscrafwgpyaaskaavevmarcwa
    eetkkmklkinsvnpgatrtamraqampgedpetlptpqsvaekivkladpklevtgklf
    dvrqdrfldyhmps
    

    Sequence, based on observed residues (ATOM records): (download)
    >4z0tA (A:)
    idltgrlalvtgasrgigyflslelakrgahviavartvggleelddeirklgssatlvp
    lditdmealdrlggtiherwgkldilvanagilgtispighveaktfekvmninvtsvwr
    lirsvdpllrasdagraimlssgvahscrafwgpyaaskaavevmarcwaeetkkmklki
    nsvnpgatrtamraqampgedpetlptpqsvaekivkladpklevtgklfdvrqdrfldy
    hmps