PDB entry 4z0j

View 4z0j on RCSB PDB site
Description: F96S/S73A Double mutant of Plasmodium Falciparum Triosephosphate Isomerase
Class: isomerase
Keywords: tim barrels, beta-alpha barrels, isomerase, glycolysis
Deposited on 2015-03-26, released 2016-02-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-04-20, with a file datestamp of 2016-04-15.
Experiment type: XRAY
Resolution: 2.07 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: triosephosphate isomerase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: tpi
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q07412 (Start-247)
      • engineered mutation (72)
      • engineered mutation (95)
      • engineered mutation (162)
    Domains in SCOPe 2.07: d4z0ja_
  • Chain 'B':
    Compound: triosephosphate isomerase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: tpi
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q07412 (Start-247)
      • engineered mutation (72)
      • engineered mutation (95)
      • engineered mutation (162)
    Domains in SCOPe 2.07: d4z0jb_
  • Heterogens: EDO, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4z0jA (A:)
    markyfvaanwkcngtlesiksltnsfnnldfdpskldvvvfpvsvhydhtrkllqskfs
    tgiqnvskfgngaytgevsaeiakdlnieyviighserrkyfhetdedvreklqaslknn
    lkavvcfgesleqreqnktievitkqvkafvdlidnfdnvilvyeplwaigtgktatpeq
    aqlvhkeirkivkdtcgekqanqirilyggsvntencssliqqedidgflvgnaslkesf
    vdiiksam
    

    Sequence, based on observed residues (ATOM records): (download)
    >4z0jA (A:)
    arkyfvaanwkcngtlesiksltnsfnnldfdpskldvvvfpvsvhydhtrkllqskfst
    giqnvskfgngaytgevsaeiakdlnieyviighserrkyfhetdedvreklqaslknnl
    kavvcfgesleqreqnktievitkqvkafvdlidnfdnvilvyeplwaiktatpeqaqlv
    hkeirkivkdtcgekqanqirilyggsvntencssliqqedidgflvgnaslkesfvdii
    ksam
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4z0jB (B:)
    markyfvaanwkcngtlesiksltnsfnnldfdpskldvvvfpvsvhydhtrkllqskfs
    tgiqnvskfgngaytgevsaeiakdlnieyviighserrkyfhetdedvreklqaslknn
    lkavvcfgesleqreqnktievitkqvkafvdlidnfdnvilvyeplwaigtgktatpeq
    aqlvhkeirkivkdtcgekqanqirilyggsvntencssliqqedidgflvgnaslkesf
    vdiiksam
    

    Sequence, based on observed residues (ATOM records): (download)
    >4z0jB (B:)
    arkyfvaanwkcngtlesiksltnsfnnldfdpskldvvvfpvsvhydhtrkllqskfst
    giqnvskfgngaytgevsaeiakdlnieyviighserrkyfhetdedvreklqaslknnl
    kavvcfgesleqreqnktievitkqvkafvdlidnfdnvilvyeplwaigtgktatpeqa
    qlvhkeirkivkdtcgekqanqirilyggsvntencssliqqedidgflvgnaslkesfv
    diiksam