PDB entry 4yz3

View 4yz3 on RCSB PDB site
Description: Crystal Structure of Streptococcus pneumoniae NanC, in complex with Oseltamivir.
Class: hydrolase
Keywords: Sialidase, Neuraminidase, Beta-propeller, CBM40, hydrolase
Deposited on 2015-03-24, released 2016-04-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-04-20, with a file datestamp of 2016-04-15.
Experiment type: XRAY
Resolution: 2.38 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neuraminidase
    Species: Streptococcus pneumoniae serotype 4 [TaxId:170187]
    Gene: SP_1326
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4yz3a1, d4yz3a2
  • Chain 'B':
    Compound: Neuraminidase
    Species: Streptococcus pneumoniae serotype 4 [TaxId:170187]
    Gene: SP_1326
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q97Q99 (20-676)
      • expression tag (19)
    Domains in SCOPe 2.06: d4yz3b1, d4yz3b2, d4yz3b3
  • Heterogens: G39, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4yz3A (A:)
    mahhhhhhssglevlfqgpntpvleknnvtltgggenvtkelkdkftsgdftvvikynqs
    sekglqalfgisnskpgqqnsyvdvflrdngelgmeardtssnknnlvsrpasvwgkykq
    eavtntvavvadsvkktyslyangtkvvekkvdnflnikdikgidyymlggvkragktaf
    gfngtlenikffnsaldeetvkkmttnavtghliytandttgsnyfripvlytfsngrvf
    ssidaryggthdflnkiniatsysddngktwtkpkltlafddfapvplewprevggrdlq
    isggatyidsvivekknkqvlmfadvmpagvsfreatrkdsgykqidgnyylklrkqgdt
    dynytirengtvyddrtnrptefsvdknfgikqngnyltveqysvsfennkkteyrngtk
    vhmnifykdalfkvvptnyiayissndhgeswsaptllppimglnrnapylgpgrgiies
    stgrilipsytgkesafiysddngaswkvkvvplpsswsaeaqfvelspgviqaymrtnn
    gkiayltskdagttwsapeylkfvsnpsygtqlsiinysqlidgkkavilstpnstngrk
    hgqiwiglinddntidwryhhdvdysnygysystltelpnheiglmfekfdswsrnelhm
    knvvpyitfkiedlkkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4yz3A (A:)
    tpvleknnvtltgggenvtkelkdkftsgdftvvikynqssekglqalfgisnskpgqqn
    syvdvflrdngelgmeardtssnknnlvsrpasvwgkykqeavtntvavvadsvkktysl
    yangtkvvekkvdnflnikdikgidyymlggvkragktafgfngtlenikffnsaldeet
    vkkmttnavtghliytandttgsnyfripvlytfsngrvfssidaryggthdflnkinia
    tsysddngktwtkpkltlafddfapvplewprevggrdlqisggatyidsvivekknkqv
    lmfadvmpagvsfreatrkdsgykqidgnyylklrkqgdtdynytirengtvyddrtnrp
    tefsvdknfgikqngnyltveqysvsfkkteyrngtkvhmnifykdalfkvvptnyiayi
    ssndhgeswsaptllppimglnrnapylgpgrgiiesstgrilipsytgkesafiysddn
    gaswkvkvvplpsswsaeaqfvelspgviqaymrtnngkiayltskdagttwsapeylkf
    vsnpsygtqlsiinysqlidgkkavilstpnstngrkhgqiwiglinddntidwryhhdv
    dysnygysystltelpnheiglmfekfdswsrnelhmknvvpyitfkiedlkkn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4yz3B (B:)
    mahhhhhhssglevlfqgpntpvleknnvtltgggenvtkelkdkftsgdftvvikynqs
    sekglqalfgisnskpgqqnsyvdvflrdngelgmeardtssnknnlvsrpasvwgkykq
    eavtntvavvadsvkktyslyangtkvvekkvdnflnikdikgidyymlggvkragktaf
    gfngtlenikffnsaldeetvkkmttnavtghliytandttgsnyfripvlytfsngrvf
    ssidaryggthdflnkiniatsysddngktwtkpkltlafddfapvplewprevggrdlq
    isggatyidsvivekknkqvlmfadvmpagvsfreatrkdsgykqidgnyylklrkqgdt
    dynytirengtvyddrtnrptefsvdknfgikqngnyltveqysvsfennkkteyrngtk
    vhmnifykdalfkvvptnyiayissndhgeswsaptllppimglnrnapylgpgrgiies
    stgrilipsytgkesafiysddngaswkvkvvplpsswsaeaqfvelspgviqaymrtnn
    gkiayltskdagttwsapeylkfvsnpsygtqlsiinysqlidgkkavilstpnstngrk
    hgqiwiglinddntidwryhhdvdysnygysystltelpnheiglmfekfdswsrnelhm
    knvvpyitfkiedlkkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4yz3B (B:)
    ntpvleknnvtltgggenvtkelkdkftsgdftvvikynqssekglqalfgisnskpgqq
    nsyvdvflrdngelgmeardtssnknnlvsrpasvwgkykqeavtntvavvadsvkktys
    lyangtkvvekkvdnflnikdikgidyymlggvkragktafgfngtlenikffnsaldee
    tvkkmttnavtghliytandttgsnyfripvlytfsngrvfssidaryggthdflnkini
    atsysddngktwtkpkltlafddfapvplewprevggrdlqisggatyidsvivekknkq
    vlmfadvmpagvsfreatrkdsgykqidgnyylklrkqgdtdynytirengtvyddrtnr
    ptefsvdknfgikqngnyltveqysvsfekkteyrngtkvhmnifykdalfkvvptnyia
    yissndhgeswsaptllppimglnrnapylgpgrgiiesstgrilipsytgkesafiysd
    dngaswkvkvvplpsswsaeaqfvelspgviqaymrtnngkiayltskdagttwsapeyl
    kfvsnpsygtqlsiinysqlidgkkavilstpnstngrkhgqiwiglinddntidwryhh
    dvdysnygysystltelpnheiglmfekfdswsrnelhmknvvpyitfkiedlkkn