PDB entry 4yya

View 4yya on RCSB PDB site
Description: The structure of hemagglutinin from a H6N1 influenza virus (A/Taiwan/2/2013) in complex with avian receptor analog 3'SLNLN
Class: immune system
Keywords: Hemagglutinin, IMMUNE SYSTEM
Deposited on 2015-03-23, released 2016-04-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-04-13, with a file datestamp of 2016-04-08.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ha1
    Species: unidentified influenza virus [TaxId:119212]
    Database cross-references and differences (RAF-indexed):
    • PDB 4YYA (0-324)
    Domains in SCOPe 2.06: d4yyaa_
  • Chain 'B':
    Compound: ha2
    Species: unidentified influenza virus [TaxId:119212]
    Database cross-references and differences (RAF-indexed):
    • PDB 4YYA (0-170)
    Domains in SCOPe 2.06: d4yyab_
  • Heterogens: NAG, SIA, GAL, BMA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4yyaA (A:)
    dkicigyhannsttqvdtlleknvtvthsvellenqkekrfckimnkapldlkdctiegw
    ilgnpkcdlllgdqswsyiverpnaqngicypgvlneleelkafigsgerverfemfpks
    twagvdtsrgvtnacpsytldssfyrnlvwlvktdsatypvikgtynntgtqpilyfwgv
    hhpldttvqdnlygsgdkyvrmgtesmnfakspeiaarpavngqrsridyywsvlrpget
    lnvesngnliapwyaykfvstnkkgavfksdlpiencdatcqtitgvlrtnktfqnvspl
    wigecpkyvkseslrlatglrnvpq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4yyaB (B:)
    gifgaiagfieggwtgmidgwygyhhensqgsgyaadrestqkaidgitnkvnsiinkmn
    tqfeavdhefsnlerrignlnkrmedgfldvwtynaellvllenertldlhdanvknlye
    kvksqlrdnandlgngcfefwhkcdnecmesvkngtydypkyqkesklnrq