PDB entry 4yy0

View 4yy0 on RCSB PDB site
Description: The structure of hemagglutinin from a H6N1 influenza virus (A/chicken/Taiwan/A2837/2013)
Class: immune system
Keywords: Hemagglutinin, IMMUNE SYSTEM
Deposited on 2015-03-23, released 2016-03-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-03-23, with a file datestamp of 2016-03-18.
Experiment type: XRAY
Resolution: 2.59 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ha1
    Species: unidentified influenza virus [TaxId:119212]
    Database cross-references and differences (RAF-indexed):
    • PDB 4YY0 (0-324)
    Domains in SCOPe 2.06: d4yy0a_
  • Chain 'B':
    Compound: ha2
    Species: unidentified influenza virus [TaxId:119212]
    Database cross-references and differences (RAF-indexed):
    • PDB 4YY0 (0-158)
    Domains in SCOPe 2.06: d4yy0b_
  • Chain 'C':
    Compound: ha1
    Species: unidentified influenza virus [TaxId:119212]
    Database cross-references and differences (RAF-indexed):
    • PDB 4YY0 (0-324)
    Domains in SCOPe 2.06: d4yy0c_
  • Chain 'D':
    Compound: ha2
    Species: unidentified influenza virus [TaxId:119212]
    Database cross-references and differences (RAF-indexed):
    • PDB 4YY0 (0-158)
    Domains in SCOPe 2.06: d4yy0d_
  • Chain 'E':
    Compound: ha1
    Species: unidentified influenza virus [TaxId:119212]
    Database cross-references and differences (RAF-indexed):
    • PDB 4YY0 (0-324)
    Domains in SCOPe 2.06: d4yy0e_
  • Chain 'F':
    Compound: ha2
    Species: unidentified influenza virus [TaxId:119212]
    Database cross-references and differences (RAF-indexed):
    • PDB 4YY0 (0-158)
    Domains in SCOPe 2.06: d4yy0f_
  • Heterogens: 5AX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4yy0A (A:)
    dkicigyhannsttqvdtlleknvtvthsvellenqkekrfckimnkapldlkdctiegw
    ilgnpkcdlllgdqswsyiverpnaqngicypgvlneleelkafigsgerverfemfpks
    twagvdtsrgvtnacpsytldssfyrnlvwlvktdsatypvikgtynntgtqpilyfwgv
    hhppdttvqdnlygsgdkyvrmgtesmnfakspeiaarpavngqrsridyywsvlrpget
    lnvesngnliapwyaykfvstnkkgavfksdlpiencdatcqtiagvlktnktfqnvspl
    wigecpkyvkseslrlatglrnvpq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4yy0B (B:)
    gifgaiagfieggwtgmidgwygyhhensqgsgyaadrestqkaidgitnkvnsiinkmn
    tqfeavdhefsnlerrignlnkrmedgfldvwtynaellvllenertldlhdanvknlye
    kvksqlrdnandlgngcfefwhkcdnecmesvkngtydy
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4yy0C (C:)
    dkicigyhannsttqvdtlleknvtvthsvellenqkekrfckimnkapldlkdctiegw
    ilgnpkcdlllgdqswsyiverpnaqngicypgvlneleelkafigsgerverfemfpks
    twagvdtsrgvtnacpsytldssfyrnlvwlvktdsatypvikgtynntgtqpilyfwgv
    hhppdttvqdnlygsgdkyvrmgtesmnfakspeiaarpavngqrsridyywsvlrpget
    lnvesngnliapwyaykfvstnkkgavfksdlpiencdatcqtiagvlktnktfqnvspl
    wigecpkyvkseslrlatglrnvpq
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4yy0D (D:)
    gifgaiagfieggwtgmidgwygyhhensqgsgyaadrestqkaidgitnkvnsiinkmn
    tqfeavdhefsnlerrignlnkrmedgfldvwtynaellvllenertldlhdanvknlye
    kvksqlrdnandlgngcfefwhkcdnecmesvkngtydy
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4yy0E (E:)
    dkicigyhannsttqvdtlleknvtvthsvellenqkekrfckimnkapldlkdctiegw
    ilgnpkcdlllgdqswsyiverpnaqngicypgvlneleelkafigsgerverfemfpks
    twagvdtsrgvtnacpsytldssfyrnlvwlvktdsatypvikgtynntgtqpilyfwgv
    hhppdttvqdnlygsgdkyvrmgtesmnfakspeiaarpavngqrsridyywsvlrpget
    lnvesngnliapwyaykfvstnkkgavfksdlpiencdatcqtiagvlktnktfqnvspl
    wigecpkyvkseslrlatglrnvpq
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4yy0F (F:)
    gifgaiagfieggwtgmidgwygyhhensqgsgyaadrestqkaidgitnkvnsiinkmn
    tqfeavdhefsnlerrignlnkrmedgfldvwtynaellvllenertldlhdanvknlye
    kvksqlrdnandlgngcfefwhkcdnecmesvkngtydy