PDB entry 4yxr

View 4yxr on RCSB PDB site
Description: CRYSTAL STRUCTURE OF PKA IN COMPLEX WITH inhibitor.
Class: transferase
Keywords: COMPLEX (PHOSPHOTRANSFERASE-INHIBITOR) complex, transferase
Deposited on 2015-03-23, released 2015-05-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-08-26, with a file datestamp of 2015-08-21.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cAMP-dependent protein kinase catalytic subunit alpha
    Species: Bos taurus [TaxId:9913]
    Gene: PRKACA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00517 (Start-349)
      • conflict (285)
    Domains in SCOPe 2.07: d4yxra_
  • Chain 'I':
    Compound: cAMP-dependent protein kinase inhibitor alpha
    Species: Bos taurus [TaxId:9913]
    Gene: Pkia
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4yxri_
  • Heterogens: 0RW, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4yxrA (A:)
    gnaaaakkgseqesvkeflakakedflkkwenpaqntahldqferiktlgtgsfgrvmlv
    khmetgnhyamkildkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvm
    eyvpggemfshlrrigrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyi
    qvtdfgfakrvkgrtwtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffa
    dqpiqiyekivsgkvrfpshfssdlkdllrnllqvdltkrfgnlkdgvndiknhkwfatt
    dwiaiyqrkveapfipkfkgpgdtsnfddyeeeeirvsinekcgkefsef
    

    Sequence, based on observed residues (ATOM records): (download)
    >4yxrA (A:)
    vkeflakakedflkkwenpaqntahldqferiktlgtgsfgrvmlvkhmetgnhyamkil
    dkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvmeyvpggemfshlrr
    igrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyiqvtdfgfakrvkgr
    twtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffadqpiqiyekivsgk
    vrfpshfssdlkdllrnllqvdltkrfgnlkdgvndiknhkwfattdwiaiyqrkveapf
    ipkfkgpgdtsnfddyeeeeirvsinekcgkefsef
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4yxrI (I:)
    ttyadfiasgrtgrrnaihd