PDB entry 4yxf

View 4yxf on RCSB PDB site
Description: MupS, a 3-oxoacyl (ACP) reductase involved in Mupirocin biosynthesis
Class: oxidoreductase
Keywords: 3-oxoacyl (ACP) reductase, mupirocin, oxidoreductase
Deposited on 2015-03-23, released 2016-04-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-04-13, with a file datestamp of 2016-04-08.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MupS
    Species: Pseudomonas fluorescens [TaxId:294]
    Gene: mupS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4yxfa_
  • Chain 'B':
    Compound: MupS
    Species: Pseudomonas fluorescens [TaxId:294]
    Gene: mupS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4yxfb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4yxfA (A:)
    mtdavsdalhtrhdsapsavkgtiivsggsqglglttvrcfleagynvatfsrrespavt
    elseradfhwqaldctdysaltafvqqvekrfggldglvnnaatgvegilstmrvadids
    aldinlkgqlyltklvtakllkrgagsvvnvssinalrghsgltvysatkaamdgltrsl
    akelgprgirvnsvspgyfssdmvkdlspqtlsrierrtplgrlgtqqevadlilylvdr
    gtfvtgqniavdggftc
    

    Sequence, based on observed residues (ATOM records): (download)
    >4yxfA (A:)
    kgtiivsggsqglglttvrcfleagynvatfsrrespavtelseradfhwqaldctdysa
    ltafvqqvekrfggldglvnnaatgvegilstmrvadidsaldinlkgqlyltklvtakl
    lkrgagsvvnvssinalrghsgltvysatkaamdgltrslakelgprgirvnsvspgyfs
    sdqtlsrierrtplgrlgtqqevadlilylvdrgtfvtgqniavdggftc
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4yxfB (B:)
    mtdavsdalhtrhdsapsavkgtiivsggsqglglttvrcfleagynvatfsrrespavt
    elseradfhwqaldctdysaltafvqqvekrfggldglvnnaatgvegilstmrvadids
    aldinlkgqlyltklvtakllkrgagsvvnvssinalrghsgltvysatkaamdgltrsl
    akelgprgirvnsvspgyfssdmvkdlspqtlsrierrtplgrlgtqqevadlilylvdr
    gtfvtgqniavdggftc
    

    Sequence, based on observed residues (ATOM records): (download)
    >4yxfB (B:)
    kgtiivsggsqglglttvrcfleagynvatfsrrespavtelseradfhwqaldctdysa
    ltafvqqvekrfggldglvnnaavegilstmrvadidsaldinlkgqlyltklvtakllk
    rgagsvvnvssinalrghsgltvysatkaamdgltrslakelgprgirvnsvspgyfssd
    qtlsrierrtplgrlgtqqevadlilylvdrgtfvtgqniavdggft