PDB entry 4yxd

View 4yxd on RCSB PDB site
Description: CRYSTAL STRUCTURE OF PORCINE HEART MITOCHONDRIAL COMPLEX II BOUND WITH flutolanil
Class: oxidoreductase/oxidoreductase inhibitor
Keywords: OXIDOREDUCTASE, SUCCINATE DEHYDROGENASE, Complex II, Inhibitor, OXIDOREDUCTASE-OXIDOREDUCTASE INHIBITOR complex
Deposited on 2015-03-23, released 2016-03-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-03-02, with a file datestamp of 2016-02-26.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4yxdb1, d4yxdb2
  • Chain 'C':
    Compound: Succinate dehydrogenase cytochrome b560 subunit, mitochondrial
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4yxdd_
  • Heterogens: FAD, FES, SF4, F3S, HEM, FTN

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4yxdB (B:)
    maavvavslkrwfpattlggaclqacrgaqtaaataprikkfaiyrwdpdktgdkphmqt
    yeidlnncgpmvldalikikneidstltfrrscregicgscamninggntlactrridtn
    ldkvskiyplphmyvikdlvpdlsnfyaqyksiepylkkkdesqegkqqylqsieerekl
    dglyecilcaccstscpsywwngdkylgpavlmqayrwmidsrddfteerlaklqdpfsl
    yrchtimnctgtcpkglnpgkaiaeikkmmatykekkasa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4yxdB (B:)
    prikkfaiyrwdpdktgdkphmqtyeidlnncgpmvldalikikneidstltfrrscreg
    icgscamninggntlactrridtnldkvskiyplphmyvikdlvpdlsnfyaqyksiepy
    lkkkdesqegkqqylqsieerekldglyecilcaccstscpsywwngdkylgpavlmqay
    rwmidsrddfteerlaklqdpfslyrchtimnctgtcpkglnpgkaiaeikkmmatyke
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4yxdD (D:)
    matlwrlsvlcgargggalvlrtsvvrpahvsaflqdrhtpgwcgvqhihlspshqassk
    aaslhwtgervvsvlllgllpaaylnpcsamdyslaaaltlhghwgigqvvtdyvrgdal
    qkvakagllalsaftfaglcyfnyhdvgickavamlwkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4yxdD (D:)
    sskaaslhwtgervvsvlllgllpaaylnpcsamdyslaaaltlhghwgigqvvtdyvrg
    dalqkvakagllalsaftfaglcyfnyhdvgickavamlwkl