PDB entry 4yw4

View 4yw4 on RCSB PDB site
Description: Streptococcus pneumoniae sialidase NanC
Class: hydrolase
Keywords: Sialidase, Neuraminidase, NanC, CBM40, hydrolase
Deposited on 2015-03-20, released 2016-04-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-30, with a file datestamp of 2017-08-25.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neuraminidase C
    Species: Streptococcus pneumoniae [TaxId:1313]
    Gene: nanC, SPG_1219
    Database cross-references and differences (RAF-indexed):
    • Uniprot B5E561 (0-657)
      • expression tag (658)
    Domains in SCOPe 2.07: d4yw4a1, d4yw4a2, d4yw4a3
  • Chain 'B':
    Compound: Neuraminidase C
    Species: Streptococcus pneumoniae [TaxId:1313]
    Gene: nanC, SPG_1219
    Database cross-references and differences (RAF-indexed):
    • Uniprot B5E561 (0-657)
      • expression tag (658)
    Domains in SCOPe 2.07: d4yw4b1, d4yw4b2, d4yw4b3
  • Heterogens: PO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4yw4A (A:)
    etpvleknnvtltgggenvtkelkdkftsgdftvvikynqssekglqalfgisnskpgqq
    nsyvdvflrdngelgmeardtssnknnlvsrpasvwgkykqeavtntvavvadsvkktys
    lyangtkvvekkvdnflnikdikgidyymlggvkragktafgfngtlenikffnsaldee
    tvkkmttnavtghliytandttgsnyfripvlytfsngrvfssidaryggthdflnkini
    atsysddngktwtkpkltlafddfapvplewprevggrdlqisggatyidsvivekknkq
    vlmfadvmpagvsfreatrkdsgykqidgnyylklrkqgdtdynytirengtvyddrtnr
    ptefsvdknfgikqngnyltveqysvsfennkkteyrngtkvhmnifykdalfkvvptny
    iayissndhgeswsaptllppimglnrnapylgpgrgiiesstgrilipsytgkesafiy
    sddngaswkvkvvplpsswsaeaqfvelspgviqaymrtnngkiayltskdagttwsape
    ylkfvsnpsygtqlsiinysqlidgkkavilstpnstngrkhgqiwiglinddntidwry
    hhdvdysnygysystltelpnheiglmfekfdswsrnelhmknvvpyitfkiedlkknl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4yw4B (B:)
    etpvleknnvtltgggenvtkelkdkftsgdftvvikynqssekglqalfgisnskpgqq
    nsyvdvflrdngelgmeardtssnknnlvsrpasvwgkykqeavtntvavvadsvkktys
    lyangtkvvekkvdnflnikdikgidyymlggvkragktafgfngtlenikffnsaldee
    tvkkmttnavtghliytandttgsnyfripvlytfsngrvfssidaryggthdflnkini
    atsysddngktwtkpkltlafddfapvplewprevggrdlqisggatyidsvivekknkq
    vlmfadvmpagvsfreatrkdsgykqidgnyylklrkqgdtdynytirengtvyddrtnr
    ptefsvdknfgikqngnyltveqysvsfennkkteyrngtkvhmnifykdalfkvvptny
    iayissndhgeswsaptllppimglnrnapylgpgrgiiesstgrilipsytgkesafiy
    sddngaswkvkvvplpsswsaeaqfvelspgviqaymrtnngkiayltskdagttwsape
    ylkfvsnpsygtqlsiinysqlidgkkavilstpnstngrkhgqiwiglinddntidwry
    hhdvdysnygysystltelpnheiglmfekfdswsrnelhmknvvpyitfkiedlkknl