PDB entry 4yw2

View 4yw2 on RCSB PDB site
Description: Crystal Structure of Streptococcus pneumoniae NanC, complex 6'SL
Class: hydrolase
Keywords: Sialidase, Neuraminidase, 6'SL, CBM40, hydrolase
Deposited on 2015-03-20, released 2015-09-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-11-25, with a file datestamp of 2015-11-20.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sialidase b
    Species: Streptococcus pneumoniae [TaxId:1313]
    Gene: nanB_2, ERS019716_01554
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4yw2a1, d4yw2a2, d4yw2a3
  • Chain 'B':
    Compound: sialidase b
    Species: Streptococcus pneumoniae [TaxId:1313]
    Gene: nanB_2, ERS019716_01554
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4yw2b1, d4yw2b2, d4yw2b3
  • Heterogens: PO4, GOL, PEG, SIA, GAL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4yw2A (A:)
    etpvleknnvtltgggenvtkelkdkftsgdftvvikynqssekglqalfgisnskpgqq
    nsyvdvflrdngelgmeardtssnknnlvsrpasvwgkykqeavtntvavvadsvkktys
    lyangtkvvekkvdnflnikdikgidyymlggvkragktafgfngtlenikffnsaldee
    tvkkmttnavtghliytandttgsnyfripvlytfsngrvfssidaryggthdflnkini
    atsysddngktwtkpkltlafddfapvplewprevggrdlqisggatyidsvivekknkq
    vlmfadvmpagvsfreatrkdsgykqidgnyylklrkqgdtdynytirengtvyddrtnr
    ptefsvdknfgikqngnyltveqysvsfennkkteyrngtkvhmnifykdalfkvvptny
    iayissndhgeswsaptllppimglnrnapylgpgrgiiesstgrilipsytgkesafiy
    sddngaswkvkvvplpsswsaeaqfvelspgviqaymrtnngkiayltskdagttwsape
    ylkfvsnpsygtqlsiinysqlidgkkavilstpnstngrkhgqiwiglinddntidwry
    hhdvdysnygysystltelpnheiglmfekfdswsrnelhmknvvpyitfkiedlkknl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4yw2B (B:)
    etpvleknnvtltgggenvtkelkdkftsgdftvvikynqssekglqalfgisnskpgqq
    nsyvdvflrdngelgmeardtssnknnlvsrpasvwgkykqeavtntvavvadsvkktys
    lyangtkvvekkvdnflnikdikgidyymlggvkragktafgfngtlenikffnsaldee
    tvkkmttnavtghliytandttgsnyfripvlytfsngrvfssidaryggthdflnkini
    atsysddngktwtkpkltlafddfapvplewprevggrdlqisggatyidsvivekknkq
    vlmfadvmpagvsfreatrkdsgykqidgnyylklrkqgdtdynytirengtvyddrtnr
    ptefsvdknfgikqngnyltveqysvsfennkkteyrngtkvhmnifykdalfkvvptny
    iayissndhgeswsaptllppimglnrnapylgpgrgiiesstgrilipsytgkesafiy
    sddngaswkvkvvplpsswsaeaqfvelspgviqaymrtnngkiayltskdagttwsape
    ylkfvsnpsygtqlsiinysqlidgkkavilstpnstngrkhgqiwiglinddntidwry
    hhdvdysnygysystltelpnheiglmfekfdswsrnelhmknvvpyitfkiedlkknl