PDB entry 4yw1

View 4yw1 on RCSB PDB site
Description: Crystal Structure of Streptococcus pneumoniae NanC, complex with Neu5Ac and Neu5Ac2en following soaking with 3'SL
Class: hydrolase
Keywords: Sialidase, CBM40, hydrolase
Deposited on 2015-03-20, released 2015-09-23
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-09-23, with a file datestamp of 2015-09-18.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neuraminidase C
    Species: Streptococcus pneumoniae [TaxId:1313]
    Gene: nanC, SPG_1219
    Database cross-references and differences (RAF-indexed):
    • Uniprot B5E561 (0-657)
      • expression tag (658)
    Domains in SCOPe 2.05: d4yw1a1, d4yw1a2
  • Chain 'B':
    Compound: Neuraminidase C
    Species: Streptococcus pneumoniae [TaxId:1313]
    Gene: nanC, SPG_1219
    Database cross-references and differences (RAF-indexed):
    • Uniprot B5E561 (0-657)
      • expression tag (658)
    Domains in SCOPe 2.05: d4yw1b1, d4yw1b2
  • Heterogens: SIA, PO4, PEG, DAN, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4yw1A (A:)
    etpvleknnvtltgggenvtkelkdkftsgdftvvikynqssekglqalfgisnskpgqq
    nsyvdvflrdngelgmeardtssnknnlvsrpasvwgkykqeavtntvavvadsvkktys
    lyangtkvvekkvdnflnikdikgidyymlggvkragktafgfngtlenikffnsaldee
    tvkkmttnavtghliytandttgsnyfripvlytfsngrvfssidaryggthdflnkini
    atsysddngktwtkpkltlafddfapvplewprevggrdlqisggatyidsvivekknkq
    vlmfadvmpagvsfreatrkdsgykqidgnyylklrkqgdtdynytirengtvyddrtnr
    ptefsvdknfgikqngnyltveqysvsfennkkteyrngtkvhmnifykdalfkvvptny
    iayissndhgeswsaptllppimglnrnapylgpgrgiiesstgrilipsytgkesafiy
    sddngaswkvkvvplpsswsaeaqfvelspgviqaymrtnngkiayltskdagttwsape
    ylkfvsnpsygtqlsiinysqlidgkkavilstpnstngrkhgqiwiglinddntidwry
    hhdvdysnygysystltelpnheiglmfekfdswsrnelhmknvvpyitfkiedlkknl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4yw1B (B:)
    etpvleknnvtltgggenvtkelkdkftsgdftvvikynqssekglqalfgisnskpgqq
    nsyvdvflrdngelgmeardtssnknnlvsrpasvwgkykqeavtntvavvadsvkktys
    lyangtkvvekkvdnflnikdikgidyymlggvkragktafgfngtlenikffnsaldee
    tvkkmttnavtghliytandttgsnyfripvlytfsngrvfssidaryggthdflnkini
    atsysddngktwtkpkltlafddfapvplewprevggrdlqisggatyidsvivekknkq
    vlmfadvmpagvsfreatrkdsgykqidgnyylklrkqgdtdynytirengtvyddrtnr
    ptefsvdknfgikqngnyltveqysvsfennkkteyrngtkvhmnifykdalfkvvptny
    iayissndhgeswsaptllppimglnrnapylgpgrgiiesstgrilipsytgkesafiy
    sddngaswkvkvvplpsswsaeaqfvelspgviqaymrtnngkiayltskdagttwsape
    ylkfvsnpsygtqlsiinysqlidgkkavilstpnstngrkhgqiwiglinddntidwry
    hhdvdysnygysystltelpnheiglmfekfdswsrnelhmknvvpyitfkiedlkknl