PDB entry 4yvb

View 4yvb on RCSB PDB site
Description: Structure of D128N streptavidin
Class: Biotin binding protein
Keywords: streptavidin, biophysics, dynamics, Biotin binding protein
Deposited on 2015-03-19, released 2016-03-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-03-23, with a file datestamp of 2016-03-18.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: N/A
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22629 (0-End)
      • engineered mutation (112)
    Domains in SCOPe 2.06: d4yvba_
  • Chain 'B':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22629 (0-119)
      • engineered mutation (112)
    Domains in SCOPe 2.06: d4yvbb_
  • Chain 'C':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22629 (0-End)
      • engineered mutation (112)
    Domains in SCOPe 2.06: d4yvbc_
  • Chain 'D':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22629 (0-119)
      • engineered mutation (112)
    Domains in SCOPe 2.06: d4yvbd_
  • Heterogens: BTN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4yvbA (A:)
    gitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtalgw
    tvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghntftkvkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4yvbA (A:)
    gitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtalgw
    tvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghntftkvk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4yvbB (B:)
    gitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtalgw
    tvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghntftkvkp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4yvbC (C:)
    gitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtalgw
    tvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghntftkvkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4yvbC (C:)
    gitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtalgw
    tvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghntftkv
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4yvbD (D:)
    gitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtalgw
    tvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghntftkvkp