PDB entry 4yud

View 4yud on RCSB PDB site
Description: Crystal structure of a RNA binding motif protein 39 (RBM39) from Homo sapiens at 1.28 A resolution
Class: RNA binding protein
Keywords: RNA recognition domain, RNP-1, PF00076 family, Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-BIOLOGY, RNA BINDING PROTEIN, PARTNERSHIP FOR T-CELL BIOLOGY, TCELL
Deposited on 2015-03-18, released 2015-04-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-04-01, with a file datestamp of 2015-03-27.
Experiment type: XRAY
Resolution: 1.28 Å
R-factor: N/A
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: RNA-binding protein 39
  Species: Homo sapiens [TaxId:9606]
  Gene: RBM39, HCC1, RNPC2
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q14498 (1-End)
    • leader sequence (0)
  Domains in SCOPe 2.07: d4yuda1, d4yuda2
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >4yudA (A:)
  gnltpeerdartvfcmqlaarirprdleeffstvgkvrdvrmisdrnsrrskgiayvefv
  dvssvplaigltgqrvlgvpiivqasqaeknr
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >4yudA (A:)
  gnltpeerdartvfcmqlaarirprdleeffstvgkvrdvrmisdrnsrrskgiayvefv
  dvssvplaigltgqrvlgvpiivqasq