PDB entry 4yu9

View 4yu9 on RCSB PDB site
Description: Crystal Structure of double mutant Y115E Y117E human Glutaminyl Cyclase
Class: transferase
Keywords: Alzheimer Disease, Drug Target, Transferase
Deposited on 2015-03-18, released 2015-08-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-08-19, with a file datestamp of 2015-08-14.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutaminyl-peptide cyclotransferase
    Species: Homo sapiens [TaxId:9606]
    Gene: QPCT
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16769 (Start-328)
      • engineered mutation (82)
      • engineered mutation (84)
    Domains in SCOPe 2.07: d4yu9a_
  • Chain 'B':
    Compound: Glutaminyl-peptide cyclotransferase
    Species: Homo sapiens [TaxId:9606]
    Gene: QPCT
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16769 (Start-328)
      • engineered mutation (82)
      • engineered mutation (84)
    Domains in SCOPe 2.07: d4yu9b_
  • Chain 'C':
    Compound: Glutaminyl-peptide cyclotransferase
    Species: Homo sapiens [TaxId:9606]
    Gene: QPCT
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16769 (Start-328)
      • engineered mutation (82)
      • engineered mutation (84)
    Domains in SCOPe 2.07: d4yu9c_
  • Heterogens: ZN, SO4, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4yu9A (A:)
    asawpeeknyhqpailnssalrqiaegtsisemwqndlqpllierypgspgsyaarqhim
    qriqrlqadwvleidtflsqtpegersfsniistlnptakrhlvlachydskyfshwnnr
    vfvgatdsavpcammlelaraldkkllslktvsdskpdlslqliffdgeeaflhwspqds
    lygsrhlaakmastphppgargtsqlhgmdllvlldligapnptfpnffpnsarwferlq
    aiehelhelgllkdhslegryfqnysyggviqddhipflrrgvpvlhlipspfpevwhtm
    ddneenldestidnlnkilqvfvleylhl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4yu9A (A:)
    sawpeeknyhqpailnssalrqiaegtsisemwqndlqpllierypgspgsyaarqhimq
    riqrlqadwvleidtflsqtpegersfsniistlnptakrhlvlachydskyfshwnrvf
    vgatdsavpcammlelaraldkkllslktvsskpdlslqliffdgeeaflhwspqdslyg
    srhlaakmastphppgargtsqlhgmdllvlldligapnptfpnffpnsarwferlqaie
    helhelgllkdhslegryfqnysyggviqddhipflrrgvpvlhlipspfpevwhtmddn
    eenldestidnlnkilqvfvleylhl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4yu9B (B:)
    asawpeeknyhqpailnssalrqiaegtsisemwqndlqpllierypgspgsyaarqhim
    qriqrlqadwvleidtflsqtpegersfsniistlnptakrhlvlachydskyfshwnnr
    vfvgatdsavpcammlelaraldkkllslktvsdskpdlslqliffdgeeaflhwspqds
    lygsrhlaakmastphppgargtsqlhgmdllvlldligapnptfpnffpnsarwferlq
    aiehelhelgllkdhslegryfqnysyggviqddhipflrrgvpvlhlipspfpevwhtm
    ddneenldestidnlnkilqvfvleylhl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4yu9B (B:)
    awpeeknyhqpailnssalrqiaegtsisemwqndlqpllierypgspgsyaarqhimqr
    iqrlqadwvleidtflsqtpegersfsniistlnptakrhlvlachydskyfshwnrvfv
    gatdsavpcammlelaraldkkllslktvskpdlslqliffdgeeaflhwspqdslygsr
    hlaakmastphppgargtsqlhgmdllvlldligapnptfpnffpnsarwferlqaiehe
    lhelgllkdhslegryfqnysyggviqddhipflrrgvpvlhlipspfpevwhtmddnee
    nldestidnlnkilqvfvleylhl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4yu9C (C:)
    asawpeeknyhqpailnssalrqiaegtsisemwqndlqpllierypgspgsyaarqhim
    qriqrlqadwvleidtflsqtpegersfsniistlnptakrhlvlachydskyfshwnnr
    vfvgatdsavpcammlelaraldkkllslktvsdskpdlslqliffdgeeaflhwspqds
    lygsrhlaakmastphppgargtsqlhgmdllvlldligapnptfpnffpnsarwferlq
    aiehelhelgllkdhslegryfqnysyggviqddhipflrrgvpvlhlipspfpevwhtm
    ddneenldestidnlnkilqvfvleylhl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4yu9C (C:)
    awpeeknyhqpailnssalrqiaegtsisemwqndlqpllierypgspgsyaarqhimqr
    iqrlqadwvleidtflsqtpegersfsniistlnptakrhlvlachydskyfshwnrvfv
    gatdsavpcammlelaraldkkllslktvsdspdlslqliffdgeeaflhwspqdslygs
    rhlaakmastphppgargtsqlhgmdllvlldligapnptfpnffpnsarwferlqaieh
    elhelgllkdhslegryfqnysyggviqddhipflrrgvpvlhlipspfpevwhtmddne
    enldestidnlnkilqvfvleylhl