PDB entry 4yu3

View 4yu3 on RCSB PDB site
Description: The crystal structure of mongoose (Helogale parvula) hemoglobin at pH 8.2
Class: oxygen transport
Keywords: hemoglobin, oxygen transport, allosteric effector
Deposited on 2015-03-18, released 2015-09-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-11, with a file datestamp of 2019-12-06.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hemoglobin
    Species: Helogale parvula [TaxId:210647]
    Database cross-references and differences (RAF-indexed):
    • PDB 4YU3 (0-140)
    Domains in SCOPe 2.08: d4yu3a_
  • Chain 'B':
    Compound: hemoglobin
    Species: Helogale parvula [TaxId:210647]
    Database cross-references and differences (RAF-indexed):
    • PDB 4YU3 (0-145)
    Domains in SCOPe 2.08: d4yu3b_
  • Heterogens: HEM, OXY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4yu3A (A:)
vlspadktnikaswekigshggeygaealertflcfpttktyfphfdlshgsaqvkahgk
kvadaltnavghlddlpgalsalsdlhayklrvdpvnfkllshcllvtlashhpaeftpa
vhasldkflssvstvltskyr

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4yu3B (B:)
vhltaeekahvsglwgkvnteevggealgrllvvypwtqrffetfgdlssanaimnnpkv
kahgkkvlssfsdglknldnlkgtfaalselhcdklhvdpenfkllgnvlvcvlahhfgk
eftpqvqaayqkivagvanalahkyh