PDB entry 4ytp

View 4ytp on RCSB PDB site
Description: CRYSTAL STRUCTURE OF PORCINE HEART MITOCHONDRIAL COMPLEX II BOUND WITH N-[(4-tert-butylphenyl)methyl]-2-(trifluoromethyl)benzamide
Class: oxidoreductase/oxidoreductase inhibitor
Keywords: OXIDOREDUCTASE, SUCCINATE DEHYDROGENASE, Complex II, Inhibitor, OXIDOREDUCTASE-OXIDOREDUCTASE INHIBITOR complex
Deposited on 2015-03-18, released 2015-08-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-08-05, with a file datestamp of 2015-07-31.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4ytpb1, d4ytpb2
  • Chain 'C':
    Compound: Succinate dehydrogenase cytochrome b560 subunit, mitochondrial
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4ytpd_
  • Heterogens: FAD, FES, SF4, F3S, HEM, E23, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4ytpB (B:)
    maavvavslkrwfpattlggaclqacrgaqtaaataprikkfaiyrwdpdktgdkphmqt
    yeidlnncgpmvldalikikneidstltfrrscregicgscamninggntlactrridtn
    ldkvskiyplphmyvikdlvpdlsnfyaqyksiepylkkkdesqegkqqylqsieerekl
    dglyecilcaccstscpsywwngdkylgpavlmqayrwmidsrddfteerlaklqdpfsl
    yrchtimnctgtcpkglnpgkaiaeikkmmatykekkasa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ytpB (B:)
    prikkfaiyrwdpdktgdkphmqtyeidlnncgpmvldalikikneidstltfrrscreg
    icgscamninggntlactrridtnldkvskiyplphmyvikdlvpdlsnfyaqyksiepy
    lkkkdesqegkqqylqsieerekldglyecilcaccstscpsywwngdkylgpavlmqay
    rwmidsrddfteerlaklqdpfslyrchtimnctgtcpkglnpgkaiaeikkmmatyke
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4ytpD (D:)
    matlwrlsvlcgargggalvlrtsvvrpahvsaflqdrhtpgwcgvqhihlspshqassk
    aaslhwtgervvsvlllgllpaaylnpcsamdyslaaaltlhghwgigqvvtdyvrgdal
    qkvakagllalsaftfaglcyfnyhdvgickavamlwkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ytpD (D:)
    sskaaslhwtgervvsvlllgllpaaylnpcsamdyslaaaltlhghwgigqvvtdyvrg
    dalqkvakagllalsaftfaglcyfnyhdvgickavamlwkl