PDB entry 4ysx

View 4ysx on RCSB PDB site
Description: Crystal structure of Mitochondrial rhodoquinol-fumarate reductase from Ascaris suum with the specific inhibitor NN23
Class: oxidoreductase/oxidoreductase inhibitor
Keywords: rhodoquinol-fumarate reductase, Complex II, OXIDOREDUCTASE-OXIDOREDUCTASE INHIBITOR complex
Deposited on 2015-03-17, released 2015-08-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-06, with a file datestamp of 2017-12-01.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Succinate dehydrogenase flavoprotein
    Species: Ascaris suum [TaxId:6253]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial
    Species: Ascaris suum [TaxId:6253]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ysxb1, d4ysxb2
  • Chain 'C':
    Compound: Cytochrome b-large subunit
    Species: Ascaris suum [TaxId:6253]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial
    Species: Ascaris suum [TaxId:6253]
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Succinate dehydrogenase flavoprotein
    Species: Ascaris suum [TaxId:6253]
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial
    Species: Ascaris suum [TaxId:6253]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ysxf1, d4ysxf2
  • Chain 'G':
    Compound: Cytochrome b-large subunit
    Species: Ascaris suum [TaxId:6253]
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial
    Species: Ascaris suum [TaxId:6253]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: MLI, FAD, FES, SF4, F3S, E23, HEM, EPH, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4ysxB (B:)
    mlrgstsvcrslelvtqaaryasaataaaptgkriktfeiyrfnpeepgakpklqkfdvd
    ldkcgtmvldalikiknevdptltfrrscregicgscamniagentlacicnidqntskt
    tkiyplphmfvikdlvpdmnlfyaqyasiqpwlqkktkinlgekqqyqsikeqekldgly
    ecilcaccsascpsywwnadkylgpavlmqayrwiidsrddsaaerlarmqdgfsafkch
    timnctktcpkhlnparaigeikmlltkmktkpaplptpanf
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ysxB (B:)
    kriktfeiyrfnpeepgakpklqkfdvdldkcgtmvldalikiknevdptltfrrscreg
    icgscamniagentlacicnidqntskttkiyplphmfvikdlvpdmnlfyaqyasiqpw
    lqkktkinlgekqqyqsikeqekldglyecilcaccsascpsywwnadkylgpavlmqay
    rwiidsrddsaaerlarmqdgfsafkchtimnctktcpkhlnparaigeikmlltkmktk
    paplptpanf
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4ysxF (F:)
    mlrgstsvcrslelvtqaaryasaataaaptgkriktfeiyrfnpeepgakpklqkfdvd
    ldkcgtmvldalikiknevdptltfrrscregicgscamniagentlacicnidqntskt
    tkiyplphmfvikdlvpdmnlfyaqyasiqpwlqkktkinlgekqqyqsikeqekldgly
    ecilcaccsascpsywwnadkylgpavlmqayrwiidsrddsaaerlarmqdgfsafkch
    timnctktcpkhlnparaigeikmlltkmktkpaplptpanf
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ysxF (F:)
    tgkriktfeiyrfnpeepgakpklqkfdvdldkcgtmvldalikiknevdptltfrrscr
    egicgscamniagentlacicnidqntskttkiyplphmfvikdlvpdmnlfyaqyasiq
    pwlqkktkinlgekqqyqsikeqekldglyecilcaccsascpsywwnadkylgpavlmq
    ayrwiidsrddsaaerlarmqdgfsafkchtimnctktcpkhlnparaigeikmlltkmk
    tkpaplptpanf
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.