PDB entry 4ysv

View 4ysv on RCSB PDB site
Description: Structure of aminoacid racemase in apo-form
Class: isomerase
Keywords: fold type I of PLP-dependent enzyme, ISOMERASE
Deposited on 2015-03-17, released 2016-04-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-05-17, with a file datestamp of 2017-05-12.
Experiment type: XRAY
Resolution: 2.77 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative 4-aminobutyrate aminotransferase
    Species: Lactobacillus buchneri [TaxId:1581]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ysva_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ysvA (A:)
    gsggiegrhmelmgkldkasklideenkyyarsarinyynlvidhahgatlvdvdgnkyi
    dllasasainvghthekvvkaiadqaqklihytpayfhhvpgmelseklakiapgnspkm
    vsfgnsgsdandaiikfaraytgrqyivsymgsyhgstygsqtlsgsslnmtrkigpmlp
    svvhvpypdsyrtypgetehdvslryfnefkkpfesflpadetacvliepiqgdggiika
    peeymqlvykfchehgilfaidevnqglgrtgkmwaiqqfkdiepdlmsvgkslasgmpl
    savigkkevmqsldapahlfttagnpvcsaaslatldvieyeglveksatdgayakqrfl
    emqqrhpmigdvrmwglnggielvkdpktkepdsdaatkviyyafahgvviitlagnilr
    fqpplvipreqldqalqvlddaftavengevtipkdtgkigw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ysvA (A:)
    lvidhahgatlvdvdgnkyidllsainvghthekvvkaiadqaqklihytpayfhhvpgm
    elseklakiapgnspkmvsfgnsgsdandaiikfaraytgrqyivsymgsyhgstygsqt
    lsgsslnmtrkigpmlpsvvhvpypdsyrtypgetehdvslryfnefkkpfesflpadet
    acvliepiqgdggiikapeeymqlvykfchehgilfaidevnqglgrtgkmwaiqqfkdi
    epdlmsvgkslasgmplsavigkkevmqsltagnpvcsaaslatldvieyeglveksatd
    gayakqrflemqqrhpmigdvrmwglnggielvkdpktkepdsdaatkviyyafahgvvi
    itlagnilrfqpplvipreqldqalqvlddaftavengevtip