PDB entry 4ysn

View 4ysn on RCSB PDB site
Description: Structure of aminoacid racemase in complex with PLP
Class: isomerase
Keywords: fold type I of PLP-dependent enzyme, ISOMERASE
Deposited on 2015-03-17, released 2016-04-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-05-17, with a file datestamp of 2017-05-12.
Experiment type: XRAY
Resolution: 1.94 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative 4-aminobutyrate aminotransferase
    Species: Lactobacillus buchneri [TaxId:1581]
    Database cross-references and differences (RAF-indexed):
    • Uniprot M1GRN3 (12-End)
      • expression tag (8-11)
    Domains in SCOPe 2.07: d4ysna1, d4ysna2
  • Chain 'B':
    Compound: Putative 4-aminobutyrate aminotransferase
    Species: Lactobacillus buchneri [TaxId:1581]
    Database cross-references and differences (RAF-indexed):
    • Uniprot M1GRN3 (12-End)
      • expression tag (10-11)
    Domains in SCOPe 2.07: d4ysnb1, d4ysnb2
  • Chain 'C':
    Compound: Putative 4-aminobutyrate aminotransferase
    Species: Lactobacillus buchneri [TaxId:1581]
    Database cross-references and differences (RAF-indexed):
    • Uniprot M1GRN3 (12-End)
      • expression tag (5-11)
    Domains in SCOPe 2.07: d4ysnc1, d4ysnc2
  • Chain 'D':
    Compound: Putative 4-aminobutyrate aminotransferase
    Species: Lactobacillus buchneri [TaxId:1581]
    Database cross-references and differences (RAF-indexed):
    • Uniprot M1GRN3 (12-End)
      • expression tag (10-11)
    Domains in SCOPe 2.07: d4ysnd1, d4ysnd2
  • Heterogens: PLP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ysnA (A:)
    gsggiegrhmelmgkldkasklideenkyyarsarinyynlvidhahgatlvdvdgnkyi
    dllasasainvghthekvvkaiadqaqklihytpayfhhvpgmelseklakiapgnspkm
    vsfgnsgsdandaiikfaraytgrqyivsymgsyhgstygsqtlsgsslnmtrkigpmlp
    svvhvpypdsyrtypgetehdvslryfnefkkpfesflpadetacvliepiqgdggiika
    peeymqlvykfchehgilfaidevnqglgrtgkmwaiqqfkdiepdlmsvgkslasgmpl
    savigkkevmqsldapahlfttagnpvcsaaslatldvieyeglveksatdgayakqrfl
    emqqrhpmigdvrmwglnggielvkdpktkepdsdaatkviyyafahgvviitlagnilr
    fqpplvipreqldqalqvlddaftavengevtipkdtgkigw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ysnA (A:)
    hmelmgkldkasklideenkyyarsarinyynlvidhahgatlvdvdgnkyidllasasa
    invghthekvvkaiadqaqklihytpayfhhvpgmelseklakiapgnspkmvsfgnsgs
    dandaiikfaraytgrqyivsymgsyhgstygsqtlsgsslnmtrkigpmlpsvvhvpyp
    dsyrtypgetehdvslryfnefkkpfesflpadetacvliepiqgdggiikapeeymqlv
    ykfchehgilfaidevnqglgrtgkmwaiqqfkdiepdlmsvgkslasgmplsavigkke
    vmqsldapahlfttagnpvcsaaslatldvieyeglveksatdgayakqrflemqqrhpm
    igdvrmwglnggielvkdpktkepdsdaatkviyyafahgvviitlagnilrfqpplvip
    reqldqalqvlddaftavengevtip
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4ysnB (B:)
    gsggiegrhmelmgkldkasklideenkyyarsarinyynlvidhahgatlvdvdgnkyi
    dllasasainvghthekvvkaiadqaqklihytpayfhhvpgmelseklakiapgnspkm
    vsfgnsgsdandaiikfaraytgrqyivsymgsyhgstygsqtlsgsslnmtrkigpmlp
    svvhvpypdsyrtypgetehdvslryfnefkkpfesflpadetacvliepiqgdggiika
    peeymqlvykfchehgilfaidevnqglgrtgkmwaiqqfkdiepdlmsvgkslasgmpl
    savigkkevmqsldapahlfttagnpvcsaaslatldvieyeglveksatdgayakqrfl
    emqqrhpmigdvrmwglnggielvkdpktkepdsdaatkviyyafahgvviitlagnilr
    fqpplvipreqldqalqvlddaftavengevtipkdtgkigw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ysnB (B:)
    elmgkldkasklideenkyyarsarinyynlvidhahgatlvdvdgnkyidllasasain
    vghthekvvkaiadqaqklihytpayfhhvpgmelseklakiapgnspkmvsfgnsgsda
    ndaiikfaraytgrqyivsymgsyhgstygsqtlsgsslnmtrkigpmlpsvvhvpypds
    yrtypgetehdvslryfnefkkpfesflpadetacvliepiqgdggiikapeeymqlvyk
    fchehgilfaidevnqglgrtgkmwaiqqfkdiepdlmsvgkslasgmplsavigkkevm
    qsldapahlfttagnpvcsaaslatldvieyeglveksatdgayakqrflemqqrhpmig
    dvrmwglnggielvkdpktkepdsdaatkviyyafahgvviitlagnilrfqpplvipre
    qldqalqvlddaftavengevti
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4ysnC (C:)
    gsggiegrhmelmgkldkasklideenkyyarsarinyynlvidhahgatlvdvdgnkyi
    dllasasainvghthekvvkaiadqaqklihytpayfhhvpgmelseklakiapgnspkm
    vsfgnsgsdandaiikfaraytgrqyivsymgsyhgstygsqtlsgsslnmtrkigpmlp
    svvhvpypdsyrtypgetehdvslryfnefkkpfesflpadetacvliepiqgdggiika
    peeymqlvykfchehgilfaidevnqglgrtgkmwaiqqfkdiepdlmsvgkslasgmpl
    savigkkevmqsldapahlfttagnpvcsaaslatldvieyeglveksatdgayakqrfl
    emqqrhpmigdvrmwglnggielvkdpktkepdsdaatkviyyafahgvviitlagnilr
    fqpplvipreqldqalqvlddaftavengevtipkdtgkigw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ysnC (C:)
    egrhmelmgkldkasklideenkyyarsarinyynlvidhahgatlvdvdgnkyidllas
    asainvghthekvvkaiadqaqklihytpayfhhvpgmelseklakiapgnspkmvsfgn
    sgsdandaiikfaraytgrqyivsymgsyhgstygsqtlsgsslnmtrkigpmlpsvvhv
    pypdsyrtypgetehdvslryfnefkkpfesflpadetacvliepiqgdggiikapeeym
    qlvykfchehgilfaidevnqglgrtgkmwaiqqfkdiepdlmsvgkslasgmplsavig
    kkevmqsldapahlfttagnpvcsaaslatldvieyeglveksatdgayakqrflemqqr
    hpmigdvrmwglnggielvkdpktkepdsdaatkviyyafahgvviitlagnilrfqppl
    vipreqldqalqvlddaftavengevti
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4ysnD (D:)
    gsggiegrhmelmgkldkasklideenkyyarsarinyynlvidhahgatlvdvdgnkyi
    dllasasainvghthekvvkaiadqaqklihytpayfhhvpgmelseklakiapgnspkm
    vsfgnsgsdandaiikfaraytgrqyivsymgsyhgstygsqtlsgsslnmtrkigpmlp
    svvhvpypdsyrtypgetehdvslryfnefkkpfesflpadetacvliepiqgdggiika
    peeymqlvykfchehgilfaidevnqglgrtgkmwaiqqfkdiepdlmsvgkslasgmpl
    savigkkevmqsldapahlfttagnpvcsaaslatldvieyeglveksatdgayakqrfl
    emqqrhpmigdvrmwglnggielvkdpktkepdsdaatkviyyafahgvviitlagnilr
    fqpplvipreqldqalqvlddaftavengevtipkdtgkigw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ysnD (D:)
    elmgkldkasklideenkyyarsarinyynlvidhahgatlvdvdgnkyidllasasain
    vghthekvvkaiadqaqklihytpayfhhvpgmelseklakiapgnspkmvsfgnsgsda
    ndaiikfaraytgrqyivsymgsyhgstygsqtlsgsslnmtrkigpmlpsvvhvpypds
    yrtypgetehdvslryfnefkkpfesflpadetacvliepiqgdggiikapeeymqlvyk
    fchehgilfaidevnqglgrtgkmwaiqqfkdiepdlmsvgkslasgmplsavigkkevm
    qsldapahlfttagnpvcsaaslatldvieyeglveksatdgayakqrflemqqrhpmig
    dvrmwglnggielvkdpktkepdsdaatkviyyafahgvviitlagnilrfqpplvipre
    qldqalqvlddaftavengevt