PDB entry 4yra

View 4yra on RCSB PDB site
Description: mouse TDH in the apo form
Class: oxidoreductase
Keywords: L-threonine 3-dehydrogenase, OXIDOREDUCTASE
Deposited on 2015-03-14, released 2016-02-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: L-threonine 3-dehydrogenase, mitochondrial
    Species: Mus musculus [TaxId:10090]
    Gene: tdh
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4yraa_
  • Chain 'B':
    Compound: L-threonine 3-dehydrogenase, mitochondrial
    Species: Mus musculus [TaxId:10090]
    Gene: tdh
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4yrab_
  • Chain 'C':
    Compound: L-threonine 3-dehydrogenase, mitochondrial
    Species: Mus musculus [TaxId:10090]
    Gene: tdh
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4yrac_
  • Chain 'D':
    Compound: L-threonine 3-dehydrogenase, mitochondrial
    Species: Mus musculus [TaxId:10090]
    Gene: tdh
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4yrad_
  • Chain 'E':
    Compound: L-threonine 3-dehydrogenase, mitochondrial
    Species: Mus musculus [TaxId:10090]
    Gene: tdh
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4yrae_
  • Chain 'F':
    Compound: L-threonine 3-dehydrogenase, mitochondrial
    Species: Mus musculus [TaxId:10090]
    Gene: tdh
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4yraf_
  • Chain 'G':
    Compound: L-threonine 3-dehydrogenase, mitochondrial
    Species: Mus musculus [TaxId:10090]
    Gene: tdh
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4yrag_
  • Chain 'H':
    Compound: L-threonine 3-dehydrogenase, mitochondrial
    Species: Mus musculus [TaxId:10090]
    Gene: tdh
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4yrah_
  • Chain 'I':
    Compound: L-threonine 3-dehydrogenase, mitochondrial
    Species: Mus musculus [TaxId:10090]
    Gene: tdh
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4yrai_
  • Chain 'J':
    Compound: L-threonine 3-dehydrogenase, mitochondrial
    Species: Mus musculus [TaxId:10090]
    Gene: tdh
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4yraj_
  • Chain 'K':
    Compound: L-threonine 3-dehydrogenase, mitochondrial
    Species: Mus musculus [TaxId:10090]
    Gene: tdh
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4yrak_
  • Chain 'L':
    Compound: L-threonine 3-dehydrogenase, mitochondrial
    Species: Mus musculus [TaxId:10090]
    Gene: tdh
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4yral_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4yraA (A:)
    hmstsiseaepprvlitgglgqlgvglanllrkrfgkdnvilsdirkppahvfhsgpfvy
    anildykslreivvnhriswlfhysallsavgeanvslardvnitglhnvldvaaeynvr
    lfvpstigafgptsprnpapdlciqrprtiygvskvhtelmgeyyyyrygldfrclrypg
    iisadsqpgggttdyavqifhaaakngtfecnleagtrlpmmyisdclratlevmeapae
    rlsmrtynisamsftpeelaqalrkhapdfqitycvdplrqaiaeswpmilddsnarkdw
    gwkhdfdlpelvatmlnfhgvstrvaqvn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4yraA (A:)
    epprvlitgglgqlgvglanllrkrfgkdnvilsdhsgpfvyanildykslreivvnhri
    swlfhysdvnitglhnvldvaaeynvrlfvpstigafgptsprnpapdlciqrprtiygv
    skvhtelmgeyyyyrygldfrclrypgiisadsqpgggttdyavqifhaaakngtfecnl
    eagtrlpmmyisdclratlevmeapaerlsmrtynisamsftpeelaqalrkhapdfqit
    ycvdplrqaiaeswpmilddsnarkdwgwkhdfdlpelvatmlnfhgvstrv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4yraB (B:)
    hmstsiseaepprvlitgglgqlgvglanllrkrfgkdnvilsdirkppahvfhsgpfvy
    anildykslreivvnhriswlfhysallsavgeanvslardvnitglhnvldvaaeynvr
    lfvpstigafgptsprnpapdlciqrprtiygvskvhtelmgeyyyyrygldfrclrypg
    iisadsqpgggttdyavqifhaaakngtfecnleagtrlpmmyisdclratlevmeapae
    rlsmrtynisamsftpeelaqalrkhapdfqitycvdplrqaiaeswpmilddsnarkdw
    gwkhdfdlpelvatmlnfhgvstrvaqvn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4yraB (B:)
    epprvlitgglgqlgvglanllrkrfgkdnvilsdirhsgpfvyanildykslreivvnh
    riswlfhysardvnitglhnvldvaaeynvrlfvpstigafgptsprnpapdlciqrprt
    iygvskvhtelmgeyyyyrygldfrclrypgiisadsqpgggttdyavqifhaaakngtf
    ecnleagtrlpmmyisdclratlevmeapaerlsmrtynisamsftpeelaqalrkhapd
    fqitycvdplrqaiaeswpmilddsnarkdwgwkhdfdlpelvatmlnfhgvst
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4yraC (C:)
    hmstsiseaepprvlitgglgqlgvglanllrkrfgkdnvilsdirkppahvfhsgpfvy
    anildykslreivvnhriswlfhysallsavgeanvslardvnitglhnvldvaaeynvr
    lfvpstigafgptsprnpapdlciqrprtiygvskvhtelmgeyyyyrygldfrclrypg
    iisadsqpgggttdyavqifhaaakngtfecnleagtrlpmmyisdclratlevmeapae
    rlsmrtynisamsftpeelaqalrkhapdfqitycvdplrqaiaeswpmilddsnarkdw
    gwkhdfdlpelvatmlnfhgvstrvaqvn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4yraC (C:)
    epprvlitgglgqlgvglanllrkrfgkdnvilsdirahvfhsgpfvyanildykslrei
    vvnhriswlfhysrdvnitglhnvldvaaeynvrlfvpstigafgptsprnpapdlciqr
    prtiygvskvhtelmgeyyyyrygldfrclrypgiisadsttdyavqifhaaakngtfec
    nleagtrlpmmyisdclratlevmeapaerlsmrtynisamsftpeelaqalrkhapdfq
    itycvdplrqaiaeswpmilddsnarkdwgwkhdfdlpelvatmlnfhgvstr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4yraD (D:)
    hmstsiseaepprvlitgglgqlgvglanllrkrfgkdnvilsdirkppahvfhsgpfvy
    anildykslreivvnhriswlfhysallsavgeanvslardvnitglhnvldvaaeynvr
    lfvpstigafgptsprnpapdlciqrprtiygvskvhtelmgeyyyyrygldfrclrypg
    iisadsqpgggttdyavqifhaaakngtfecnleagtrlpmmyisdclratlevmeapae
    rlsmrtynisamsftpeelaqalrkhapdfqitycvdplrqaiaeswpmilddsnarkdw
    gwkhdfdlpelvatmlnfhgvstrvaqvn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4yraD (D:)
    epprvlitgglgqlgvglanllrkrfgkdnvilsdirkppahvfhsgpfvyanildyksl
    reivvnhriswlfhyslardvnitglhnvldvaaeynvrlfvpstigafgptsprnpapd
    lciqrprtiygvskvhtelmgeyyyyrygldfrclrypgiisagttdyavqifhaaakng
    tfecnleagtrlpmmyisdclratlevmeapaerlsmrtynisamsftpeelaqalrkha
    pdfqitycvdplrqaiaeswpmilddsnarkdwgwkhdfdlpelvatmlnfh
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4yraE (E:)
    hmstsiseaepprvlitgglgqlgvglanllrkrfgkdnvilsdirkppahvfhsgpfvy
    anildykslreivvnhriswlfhysallsavgeanvslardvnitglhnvldvaaeynvr
    lfvpstigafgptsprnpapdlciqrprtiygvskvhtelmgeyyyyrygldfrclrypg
    iisadsqpgggttdyavqifhaaakngtfecnleagtrlpmmyisdclratlevmeapae
    rlsmrtynisamsftpeelaqalrkhapdfqitycvdplrqaiaeswpmilddsnarkdw
    gwkhdfdlpelvatmlnfhgvstrvaqvn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4yraE (E:)
    epprvlitgglgqlgvglanllrkrfgkdnvilsdirkppahvfhsgpfvyanildyksl
    reivvnhriswlfhysdvnitglhnvldvaaeynvrlfvpstigafgptsprnpapdlci
    qrprtiygvskvhtelmgeyyyyrygldfrclrypgiisadggttdyavqifhaaakngt
    fecnleagtrlpmmyisdclratlevmeapaerlsmrtynisamsftpeelaqalrkhap
    dfqitycvdplrqaiaeswpmilddsnarkdwgwkhdfdlpelvatmlnfh
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4yraF (F:)
    hmstsiseaepprvlitgglgqlgvglanllrkrfgkdnvilsdirkppahvfhsgpfvy
    anildykslreivvnhriswlfhysallsavgeanvslardvnitglhnvldvaaeynvr
    lfvpstigafgptsprnpapdlciqrprtiygvskvhtelmgeyyyyrygldfrclrypg
    iisadsqpgggttdyavqifhaaakngtfecnleagtrlpmmyisdclratlevmeapae
    rlsmrtynisamsftpeelaqalrkhapdfqitycvdplrqaiaeswpmilddsnarkdw
    gwkhdfdlpelvatmlnfhgvstrvaqvn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4yraF (F:)
    epprvlitgglgqlgvglanllrkrfgkdnvilsdirkppahvfhsgpfvyanildyksl
    reivvnhriswlfhysvnitglhnvldvaaeynvrlfvpstigafgptsprnpapdlciq
    rprtiygvskvhtelmgeyyyyrygldfrclrypgiisattdyavqifhaaakngtfecn
    leagtrlpmmyisdclratlevmeapaerlsmrtynisamsftpeelaqalrkhapdfqi
    tycvdplrqaiaeswpmilddsnarkdwgwkhdfdlpelvatmlnfh
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4yraG (G:)
    hmstsiseaepprvlitgglgqlgvglanllrkrfgkdnvilsdirkppahvfhsgpfvy
    anildykslreivvnhriswlfhysallsavgeanvslardvnitglhnvldvaaeynvr
    lfvpstigafgptsprnpapdlciqrprtiygvskvhtelmgeyyyyrygldfrclrypg
    iisadsqpgggttdyavqifhaaakngtfecnleagtrlpmmyisdclratlevmeapae
    rlsmrtynisamsftpeelaqalrkhapdfqitycvdplrqaiaeswpmilddsnarkdw
    gwkhdfdlpelvatmlnfhgvstrvaqvn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4yraG (G:)
    pprvlitgglgqlgvglanllrkrfgkdnvilsdirkppahvfhsgpfvyanildykslr
    eivvnhriswlfhysaardvnitglhnvldvaaeynvrlfvpstigafgptsprnpapdl
    ciqrprtiygvskvhtelmgeyyyyrygldfrclrypgiisadggttdyavqifhaaakn
    gtfecnleagtrlpmmyisdclratlevmeapaerlsmrtynisamsftpeelaqalrkh
    apdfqitycvdplrqaiaeswpmilddsnarkdwgwkhdfdlpelvatmlnfhg
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4yraH (H:)
    hmstsiseaepprvlitgglgqlgvglanllrkrfgkdnvilsdirkppahvfhsgpfvy
    anildykslreivvnhriswlfhysallsavgeanvslardvnitglhnvldvaaeynvr
    lfvpstigafgptsprnpapdlciqrprtiygvskvhtelmgeyyyyrygldfrclrypg
    iisadsqpgggttdyavqifhaaakngtfecnleagtrlpmmyisdclratlevmeapae
    rlsmrtynisamsftpeelaqalrkhapdfqitycvdplrqaiaeswpmilddsnarkdw
    gwkhdfdlpelvatmlnfhgvstrvaqvn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4yraH (H:)
    pprvlitgglgqlgvglanllrkrfgkdnvilsdirkppahvfhsgpfvyanildykslr
    eivvnhriswlfhysadvnitglhnvldvaaeynvrlfvpstigafgptsprnpapdlci
    qrprtiygvskvhtelmgeyyyyrygldfrclrypgiisadsqpgggttdyavqifhaaa
    kngtfecnleagtrlpmmyisdclratlevmeapaerlsmrtynisamsftpeelaqalr
    khapdfqitycvdplrqaiaeswpmilddsnarkdwgwkhdfdlpelvatmlnfh
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >4yraI (I:)
    hmstsiseaepprvlitgglgqlgvglanllrkrfgkdnvilsdirkppahvfhsgpfvy
    anildykslreivvnhriswlfhysallsavgeanvslardvnitglhnvldvaaeynvr
    lfvpstigafgptsprnpapdlciqrprtiygvskvhtelmgeyyyyrygldfrclrypg
    iisadsqpgggttdyavqifhaaakngtfecnleagtrlpmmyisdclratlevmeapae
    rlsmrtynisamsftpeelaqalrkhapdfqitycvdplrqaiaeswpmilddsnarkdw
    gwkhdfdlpelvatmlnfhgvstrvaqvn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4yraI (I:)
    epprvlitgglgqlgvglanllrkrfgkdnvilsdirkppahvfhsgpfvyanildyksl
    reivvnhriswlfhysardvnitglhnvldvaaeynvrlfvpstigafgptsprnpapdl
    ciqrprtiygvskvhtelmgeyyyyrygldfrclrypgiisadttdyavqifhaaakngt
    fecnleagtrlpmmyisdclratlevmeapaerlsmrtynisamsftpeelaqalrkhap
    dfqitycvdplrqaiaeswpmilddsnarkdwgwkhdfdlpelvatmlnfh
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >4yraJ (J:)
    hmstsiseaepprvlitgglgqlgvglanllrkrfgkdnvilsdirkppahvfhsgpfvy
    anildykslreivvnhriswlfhysallsavgeanvslardvnitglhnvldvaaeynvr
    lfvpstigafgptsprnpapdlciqrprtiygvskvhtelmgeyyyyrygldfrclrypg
    iisadsqpgggttdyavqifhaaakngtfecnleagtrlpmmyisdclratlevmeapae
    rlsmrtynisamsftpeelaqalrkhapdfqitycvdplrqaiaeswpmilddsnarkdw
    gwkhdfdlpelvatmlnfhgvstrvaqvn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4yraJ (J:)
    epprvlitgglgqlgvglanllrkrfgkdnvilsdirkpfhsgpfvyanildykslreiv
    vnhriswlfhysavnitglhnvldvaaeynvrlfvpstigafgptsprnpapdlciqrpr
    tiygvskvhtelmgeyyyyrygldfrclrypgiisadsggttdyavqifhaaakngtfec
    nleagtrlpmmyisdclratlevmeapaerlsmrtynisamsftpeelaqalrkhapdfq
    itycvdplrqaiaeswpmilddsnarkdwgwkhdfdlpelvatmlnfhgvst
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >4yraK (K:)
    hmstsiseaepprvlitgglgqlgvglanllrkrfgkdnvilsdirkppahvfhsgpfvy
    anildykslreivvnhriswlfhysallsavgeanvslardvnitglhnvldvaaeynvr
    lfvpstigafgptsprnpapdlciqrprtiygvskvhtelmgeyyyyrygldfrclrypg
    iisadsqpgggttdyavqifhaaakngtfecnleagtrlpmmyisdclratlevmeapae
    rlsmrtynisamsftpeelaqalrkhapdfqitycvdplrqaiaeswpmilddsnarkdw
    gwkhdfdlpelvatmlnfhgvstrvaqvn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4yraK (K:)
    epprvlitgglgqlgvglanllrkrfgkdnvilsdhsgpfvyanildykslreivvnhri
    swlfhysaardvnitglhnvldvaaeynvrlfvpstigafgptsprnpapdlciqrprti
    ygvskvhtelmgeyyyyrygldfrclrypgiisattdyavqifhaaakngtfecnleagt
    rlpmmyisdclratlevmeapaerlsmrtynisamsftpeelaqalrkhapdfqitycvd
    plrqaiaeswpmilddsnarkdwgwkhdfdlpelvatmlnfhgvst
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4yraL (L:)
    hmstsiseaepprvlitgglgqlgvglanllrkrfgkdnvilsdirkppahvfhsgpfvy
    anildykslreivvnhriswlfhysallsavgeanvslardvnitglhnvldvaaeynvr
    lfvpstigafgptsprnpapdlciqrprtiygvskvhtelmgeyyyyrygldfrclrypg
    iisadsqpgggttdyavqifhaaakngtfecnleagtrlpmmyisdclratlevmeapae
    rlsmrtynisamsftpeelaqalrkhapdfqitycvdplrqaiaeswpmilddsnarkdw
    gwkhdfdlpelvatmlnfhgvstrvaqvn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4yraL (L:)
    epprvlitgglgqlgvglanllrkrfgkdnvilsdirvfhsgpfvyanildykslreivv
    nhriswlfhysaardvnitglhnvldvaaeynvrlfvpstigafgptsprnpapdlciqr
    prtiygvskvhtelmgeyyyyrygldfrclrypgiisadsqpgggttdyavqifhaaakn
    gtfecnleagtrlpmmyisdclratlevmeapaerlsmrtynisamsftpeelaqalrkh
    apdfqitycvdplrqaiaeswpmilddsnarkdwgwkhdfdlpelvatmlnfhgvstrv