PDB entry 4yr9

View 4yr9 on RCSB PDB site
Description: mouse TDH with NAD+ bound
Class: oxidoreductase
Keywords: L-threonine 3-dehydrogenase, OXIDOREDUCTASE
Deposited on 2015-03-14, released 2016-02-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: L-threonine 3-dehydrogenase, mitochondrial
    Species: Mus musculus [TaxId:10090]
    Gene: tdh
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4yr9a_
  • Chain 'B':
    Compound: L-threonine 3-dehydrogenase, mitochondrial
    Species: Mus musculus [TaxId:10090]
    Gene: tdh
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4yr9b_
  • Chain 'C':
    Compound: L-threonine 3-dehydrogenase, mitochondrial
    Species: Mus musculus [TaxId:10090]
    Gene: tdh
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4yr9c_
  • Chain 'D':
    Compound: L-threonine 3-dehydrogenase, mitochondrial
    Species: Mus musculus [TaxId:10090]
    Gene: tdh
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4yr9d_
  • Chain 'E':
    Compound: L-threonine 3-dehydrogenase, mitochondrial
    Species: Mus musculus [TaxId:10090]
    Gene: tdh
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4yr9e_
  • Chain 'F':
    Compound: L-threonine 3-dehydrogenase, mitochondrial
    Species: Mus musculus [TaxId:10090]
    Gene: tdh
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4yr9f_
  • Heterogens: NAD, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4yr9A (A:)
    hmstsiseaepprvlitgglgqlgvglanllrkrfgkdnvilsdirkppahvfhsgpfvy
    anildykslreivvnhriswlfhysallsavgeanvslardvnitglhnvldvaaeynvr
    lfvpstigafgptsprnpapdlciqrprtiygvskvhtelmgeyyyyrygldfrclrypg
    iisadsqpgggttdyavqifhaaakngtfecnleagtrlpmmyisdclratlevmeapae
    rlsmrtynisamsftpeelaqalrkhapdfqitycvdplrqaiaeswpmilddsnarkdw
    gwkhdfdlpelvatmlnfhgvstrvaqvn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4yr9A (A:)
    pprvlitgglgqlgvglanllrkrfgkdnvilsdirkppahvfhsgpfvyanildykslr
    eivvnhriswlfhysallsavgeanvslardvnitglhnvldvaaeynvrlfvpstigaf
    gptsprnpapdlciqrprtiygvskvhtelmgeyyyyrygldfrclrypgiisadspggg
    ttdyavqifhaaakngtfecnleagtrlpmmyisdclratlevmeapaerlsmrtynisa
    msftpeelaqalrkhapdfqitycvdplrqaiaeswpmilddsnarkdwgwkhdfdlpel
    vatmlnfh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4yr9B (B:)
    hmstsiseaepprvlitgglgqlgvglanllrkrfgkdnvilsdirkppahvfhsgpfvy
    anildykslreivvnhriswlfhysallsavgeanvslardvnitglhnvldvaaeynvr
    lfvpstigafgptsprnpapdlciqrprtiygvskvhtelmgeyyyyrygldfrclrypg
    iisadsqpgggttdyavqifhaaakngtfecnleagtrlpmmyisdclratlevmeapae
    rlsmrtynisamsftpeelaqalrkhapdfqitycvdplrqaiaeswpmilddsnarkdw
    gwkhdfdlpelvatmlnfhgvstrvaqvn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4yr9B (B:)
    pprvlitgglgqlgvglanllrkrfgkdnvilsdirkppahvfhsgpfvyanildykslr
    eivvnhriswlfhysallsavgeanvslardvnitglhnvldvaaeynvrlfvpstigaf
    gptsprnpapdlciqrprtiygvskvhtelmgeyyyyrygldfrclrypgiisadpgggt
    tdyavqifhaaakngtfecnleagtrlpmmyisdclratlevmeapaerlsmrtynisam
    sftpeelaqalrkhapdfqitycvdplrqaiaeswpmilddsnarkdwgwkhdfdlpelv
    atmlnfh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4yr9C (C:)
    hmstsiseaepprvlitgglgqlgvglanllrkrfgkdnvilsdirkppahvfhsgpfvy
    anildykslreivvnhriswlfhysallsavgeanvslardvnitglhnvldvaaeynvr
    lfvpstigafgptsprnpapdlciqrprtiygvskvhtelmgeyyyyrygldfrclrypg
    iisadsqpgggttdyavqifhaaakngtfecnleagtrlpmmyisdclratlevmeapae
    rlsmrtynisamsftpeelaqalrkhapdfqitycvdplrqaiaeswpmilddsnarkdw
    gwkhdfdlpelvatmlnfhgvstrvaqvn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4yr9C (C:)
    pprvlitgglgqlgvglanllrkrfgkdnvilsdirkppahvfhsgpfvyanildykslr
    eivvnhriswlfhysallsavgeanvslardvnitglhnvldvaaeynvrlfvpstigaf
    gptsprnpapdlciqrprtiygvskvhtelmgeyyyyrygldfrclrypgiisadsqggt
    tdyavqifhaaakngtfecnleagtrlpmmyisdclratlevmeapaerlsmrtynisam
    sftpeelaqalrkhapdfqitycvdplrqaiaeswpmilddsnarkdwgwkhdfdlpelv
    atmlnfh
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4yr9D (D:)
    hmstsiseaepprvlitgglgqlgvglanllrkrfgkdnvilsdirkppahvfhsgpfvy
    anildykslreivvnhriswlfhysallsavgeanvslardvnitglhnvldvaaeynvr
    lfvpstigafgptsprnpapdlciqrprtiygvskvhtelmgeyyyyrygldfrclrypg
    iisadsqpgggttdyavqifhaaakngtfecnleagtrlpmmyisdclratlevmeapae
    rlsmrtynisamsftpeelaqalrkhapdfqitycvdplrqaiaeswpmilddsnarkdw
    gwkhdfdlpelvatmlnfhgvstrvaqvn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4yr9D (D:)
    pprvlitgglgqlgvglanllrkrfgkdnvilsdirkppahvfhsgpfvyanildykslr
    eivvnhriswlfhysallsavgeanvslardvnitglhnvldvaaeynvrlfvpstigaf
    gptsprnpapdlciqrprtiygvskvhtelmgeyyyyrygldfrclrypgiisadspggg
    ttdyavqifhaaakngtfecnleagtrlpmmyisdclratlevmeapaerlsmrtynisa
    msftpeelaqalrkhapdfqitycvdplrqaiaeswpmilddsnarkdwgwkhdfdlpel
    vatmlnfh
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4yr9E (E:)
    hmstsiseaepprvlitgglgqlgvglanllrkrfgkdnvilsdirkppahvfhsgpfvy
    anildykslreivvnhriswlfhysallsavgeanvslardvnitglhnvldvaaeynvr
    lfvpstigafgptsprnpapdlciqrprtiygvskvhtelmgeyyyyrygldfrclrypg
    iisadsqpgggttdyavqifhaaakngtfecnleagtrlpmmyisdclratlevmeapae
    rlsmrtynisamsftpeelaqalrkhapdfqitycvdplrqaiaeswpmilddsnarkdw
    gwkhdfdlpelvatmlnfhgvstrvaqvn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4yr9E (E:)
    pprvlitgglgqlgvglanllrkrfgkdnvilsdirkppahvfhsgpfvyanildykslr
    eivvnhriswlfhysallsavgeanvslardvnitglhnvldvaaeynvrlfvpstigaf
    gptsprnpapdlciqrprtiygvskvhtelmgeyyyyrygldfrclrypgiisadspggg
    ttdyavqifhaaakngtfecnleagtrlpmmyisdclratlevmeapaerlsmrtynisa
    msftpeelaqalrkhapdfqitycvdplrqaiaeswpmilddsnarkdwgwkhdfdlpel
    vatmlnfh
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4yr9F (F:)
    hmstsiseaepprvlitgglgqlgvglanllrkrfgkdnvilsdirkppahvfhsgpfvy
    anildykslreivvnhriswlfhysallsavgeanvslardvnitglhnvldvaaeynvr
    lfvpstigafgptsprnpapdlciqrprtiygvskvhtelmgeyyyyrygldfrclrypg
    iisadsqpgggttdyavqifhaaakngtfecnleagtrlpmmyisdclratlevmeapae
    rlsmrtynisamsftpeelaqalrkhapdfqitycvdplrqaiaeswpmilddsnarkdw
    gwkhdfdlpelvatmlnfhgvstrvaqvn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4yr9F (F:)
    pprvlitgglgqlgvglanllrkrfgkdnvilsdirkppahvfhsgpfvyanildykslr
    eivvnhriswlfhysallsavgeanvslardvnitglhnvldvaaeynvrlfvpstigaf
    gptsprnpapdlciqrprtiygvskvhtelmgeyyyyrygldfrclrypgiisadsqggt
    tdyavqifhaatfecnleagtrlpmmyisdclratlevmeapaerlsmrtynisamsftp
    eelaqalrkhapdfqitycvdplrqaiaeswpmilddsnarkdwgwkhdfdlpelvatml
    n