PDB entry 4yqz

View 4yqz on RCSB PDB site
Description: Crystal Structure of a putative oxidoreductase from Thermus Thermophilus HB27 (TT_P0034, TARGET EFI-513932) in its APO form
Class: oxidoreductase
Keywords: Oxidoreductase, ENZYME FUNCTION INITIATIVE, EFI, Structural Genomics
Deposited on 2015-03-13, released 2015-03-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-03-25, with a file datestamp of 2015-03-20.
Experiment type: XRAY
Resolution: 1.81 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative oxidoreductase
    Species: Thermus thermophilus [TaxId:262724]
    Gene: TT_P0034
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q746L9 (24-256)
      • expression tag (23)
    Domains in SCOPe 2.07: d4yqza1, d4yqza2
  • Chain 'B':
    Compound: Putative oxidoreductase
    Species: Thermus thermophilus [TaxId:262724]
    Gene: TT_P0034
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q746L9 (24-256)
      • expression tag (23)
    Domains in SCOPe 2.07: d4yqzb1, d4yqzb2
  • Chain 'C':
    Compound: Putative oxidoreductase
    Species: Thermus thermophilus [TaxId:262724]
    Gene: TT_P0034
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q746L9 (24-256)
      • expression tag (23)
    Domains in SCOPe 2.07: d4yqzc1, d4yqzc2
  • Chain 'D':
    Compound: Putative oxidoreductase
    Species: Thermus thermophilus [TaxId:262724]
    Gene: TT_P0034
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q746L9 (24-256)
      • expression tag (23)
    Domains in SCOPe 2.07: d4yqzd1, d4yqzd2
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4yqzA (A:)
    mhhhhhhssgvdlgtenlyfqsmmklkgkkalviaagqgigraiaeafqregaevlgatl
    hpeklqgvvpavrldardkeavfrliqgldrldvlvnaqgvvpvgglleatdqdweeafl
    lnaksvfwamqaalpkmaaqgggsviniasvaafktvpgrfiysatkaalvamtkaaale
    fapkgvrvnaicpgtvdtpslreraggeeglrafaerqllkrlgrpeeiaalavylasde
    gafatgsafvvdggmsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4yqzA (A:)
    mklkgkkalviaagqgigraiaeafqregaevlgatlhpeklqgvvpavrldardkeavf
    rliqgldrldvlvnaqgvvpvgglleatdqdweeafllnaksvfwamqaalpkmaaqggg
    sviniasvaafktvpgrfiysatkaalvamtkaaalefapkgvrvnaicpgtvdtpslre
    raggeeglrafaerqllkrlgrpeeiaalavylasdegafatgsafvvdggmsl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4yqzB (B:)
    mhhhhhhssgvdlgtenlyfqsmmklkgkkalviaagqgigraiaeafqregaevlgatl
    hpeklqgvvpavrldardkeavfrliqgldrldvlvnaqgvvpvgglleatdqdweeafl
    lnaksvfwamqaalpkmaaqgggsviniasvaafktvpgrfiysatkaalvamtkaaale
    fapkgvrvnaicpgtvdtpslreraggeeglrafaerqllkrlgrpeeiaalavylasde
    gafatgsafvvdggmsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4yqzB (B:)
    mklkgkkalviaagqgigraiaeafqregaevlgatlhpeklqgvvpavrldardkeavf
    rliqgldrldvlvnaqgvvpvgglleatdqdweeafllnaksvfwamqaalpkmaaqggg
    sviniasvaafktvpgrfiysatkaalvamtkaaalefapkgvrvnaicpgtvdtpslre
    raeglrafaerqllkrlgrpeeiaalavylasdegafatgsafvvdggmsl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4yqzC (C:)
    mhhhhhhssgvdlgtenlyfqsmmklkgkkalviaagqgigraiaeafqregaevlgatl
    hpeklqgvvpavrldardkeavfrliqgldrldvlvnaqgvvpvgglleatdqdweeafl
    lnaksvfwamqaalpkmaaqgggsviniasvaafktvpgrfiysatkaalvamtkaaale
    fapkgvrvnaicpgtvdtpslreraggeeglrafaerqllkrlgrpeeiaalavylasde
    gafatgsafvvdggmsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4yqzC (C:)
    mklkgkkalviaagqgigraiaeafqregaevlgatlhpeklqgvvpavrldardkeavf
    rliqgldrldvlvnaqgvvpvgglleatdqdweeafllnaksvfwamqaalpkmaaqggg
    sviniasvaafktvpgrfiysatkaalvamtkaaalefapkgvrvnaicpgtvdtpslre
    raggeeglrafaerqllkrlgrpeeiaalavylasdegafatgsafvvdggmsl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4yqzD (D:)
    mhhhhhhssgvdlgtenlyfqsmmklkgkkalviaagqgigraiaeafqregaevlgatl
    hpeklqgvvpavrldardkeavfrliqgldrldvlvnaqgvvpvgglleatdqdweeafl
    lnaksvfwamqaalpkmaaqgggsviniasvaafktvpgrfiysatkaalvamtkaaale
    fapkgvrvnaicpgtvdtpslreraggeeglrafaerqllkrlgrpeeiaalavylasde
    gafatgsafvvdggmsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4yqzD (D:)
    mklkgkkalviaagqgigraiaeafqregaevlgatlhpeklqgvvpavrldardkeavf
    rliqgldrldvlvnaqgvvpvgglleatdqdweeafllnaksvfwamqaalpkmaaqggg
    sviniasvaafktvpgrfiysatkaalvamtkaaalefapkgvrvnaicpgtvdtpslre
    raggeeglrafaerqllkrlgrpeeiaalavylasdegafatgsafvvdggmsl