PDB entry 4ypq

View 4ypq on RCSB PDB site
Description: Crystal structure of the ROR(gamma)t ligand binding domain in complex with 4-(1-(2-chloro-6-(trifluoromethyl)benzoyl)-1H-indazol-3-yl)benzoic acid
Class: transcription
Keywords: nuclear receptor ligand binding domain, transcription
Deposited on 2015-03-13, released 2015-12-23
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-12-23, with a file datestamp of 2015-12-18.
Experiment type: XRAY
Resolution: 2.32 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nuclear receptor ROR-gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: RORC, NR1F3, RORG, RZRG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4ypqa_
  • Heterogens: 4F1, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4ypqA (A:)
    aslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhl
    teaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkygg
    melfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqy
    nlelafhhhlckthrqsilaklppkgklrslcsqhverlqifqhlhpivvqaafpplyke
    lfs