PDB entry 4ypg

View 4ypg on RCSB PDB site
Description: Structural Insights Into the Neutralization Properties of a Human Anti-Interferon Monoclonal Antibody
Class: immune system
Keywords: therapeutic mAb, IFN-alpha2A
Deposited on 2015-03-12, released 2015-05-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-06-24, with a file datestamp of 2015-06-19.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sifalimumab light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6PJF2 (0-214)
      • conflict (8)
      • conflict (27)
      • conflict (31)
      • conflict (48-49)
      • conflict (51)
      • conflict (95-96)
      • conflict (100)
      • conflict (105)
    Domains in SCOPe 2.07: d4ypga1, d4ypga2
  • Chain 'B':
    Compound: Sifalimumab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4YPG (0-218)
  • Chain 'C':
    Compound: Interferon alpha-2
    Species: Homo sapiens [TaxId:9606]
    Gene: IFNA2, IFNA2A, IFNA2B, IFNA2C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01563 (2-End)
      • expression tag (0-1)
    Domains in SCOPe 2.07: d4ypgc1, d4ypgc2
  • Chain 'D':
    Compound: Interferon alpha-2
    Species: Homo sapiens [TaxId:9606]
    Gene: IFNA2, IFNA2A, IFNA2B, IFNA2C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01563 (2-160)
      • expression tag (0-1)
    Domains in SCOPe 2.07: d4ypgd1, d4ypgd2
  • Chain 'H':
    Compound: Sifalimumab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4YPG (0-218)
  • Chain 'L':
    Compound: Sifalimumab light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6PJF2 (0-214)
      • conflict (8)
      • conflict (27)
      • conflict (31)
      • conflict (48-49)
      • conflict (51)
      • conflict (95-96)
      • conflict (100)
      • conflict (105)
    Domains in SCOPe 2.07: d4ypgl1, d4ypgl2
  • Heterogens: NI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4ypgA (A:)
    eivltqspgtlslspgeratlscrasqsvsstylawyqqkpgqaprlliygassratgip
    drfsgsgsgtdftltisrlepedfavyycqqygssprtfgqgtkveikrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrgec
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4ypgC (C:)
    tscdlpqthslgsrrtlmllaqmrkislfsclkdrhdfgfpqeefgnqfqkaetipvlhe
    miqqifnlfstkdssaawdetlldkfytelyqqlndleacviqgvgvtetplmkedsila
    vrkyfqritlylkekkyspcawevvraeimrsfslstnlqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ypgC (C:)
    tscdlpqthslgsrrtlmllaqmrkislfsclkdrhdfgfpqeefgnqfqkaetipvlhe
    miqqifnlfstkdssaawdetlldkfytelyqqlndleacviqgvgvtetplmkedsila
    vrkyfqritlylkekkyspcawevvraeimrsfslstnl
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4ypgD (D:)
    tscdlpqthslgsrrtlmllaqmrkislfsclkdrhdfgfpqeefgnqfqkaetipvlhe
    miqqifnlfstkdssaawdetlldkfytelyqqlndleacviqgvgvtetplmkedsila
    vrkyfqritlylkekkyspcawevvraeimrsfslstnlqe
    

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4ypgL (L:)
    eivltqspgtlslspgeratlscrasqsvsstylawyqqkpgqaprlliygassratgip
    drfsgsgsgtdftltisrlepedfavyycqqygssprtfgqgtkveikrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrgec