PDB entry 4yoz

View 4yoz on RCSB PDB site
Description: p107 pocket domain in complex with HPV E7 peptide
Class: transcription
Keywords: Pocket protein, Cyclin Box, Transcriptional regulator, Cell Cycle, TRANSCRIPTION
Deposited on 2015-03-12, released 2015-06-24
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-06-24, with a file datestamp of 2015-06-19.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Retinoblastoma-like protein 1,Retinoblastoma-like protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: RBL1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28749 (3-205)
      • expression tag (1-2)
      • linker (206)
    • Uniprot P28749
    Domains in SCOPe 2.05: d4yoza1, d4yoza2
  • Chain 'B':
    Compound: HPV E7 peptide
    Species: Human papillomavirus [TaxId:10566]
    Database cross-references and differences (RAF-indexed):
    • PDB 4YOZ (0-8)
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4yozA (A:)
    geftqsvsrlqsivaglknapsdqlinifescvrnpvenimkilkgigetfcqhytqstd
    eqpgshidfavnrlklaeilyykiletvmvqetrrlhgmdmsvlleqdifhrslmaccle
    ivlfayssprtfpwiievlnlqpfyfykvievvirseeglsrdmvkhlnsieeqilesla
    wshdsalwealqvsankvptceevifpnnfetgnnrpkrtgslalfyrkvyhlasvrlrd
    lclkldvsnelrrkiwtcfeftlvhcpdlmkdrhldqlllcafyimakvtkeertfqeim
    ksyrnqpqanshvyrsvllksikeergdlikfyntiyvgrvksfalkydlanqdhmmdap
    plspfphikqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4yozA (A:)
    eftqsvsrlqsivaglknapsdqlinifescvrnpvenimkilkgigetfcqhytqstde
    qpgshidfavnrlklaeilyykiletvmvqetrrlhgmdmsvlleqdifhrslmacclei
    vlfayssprtfpwiievlnlqpfyfykvievvirseeglsrdmvkhlnsieeqileslaw
    shdsalwealqvsankvptceevifpnrpkrtgslalfyrkvyhlasvrlrdlclkldvs
    nelrrkiwtcfeftlvhcpdlmkdrhldqlllcafyimakvtkeertfqeimksyrnqpq
    anshvyrsvllkergdlikfyntiyvgrvksfalkyplspfp
    

  • Chain 'B':
    No sequence available.