PDB entry 4yon

View 4yon on RCSB PDB site
Description: P-Rex1:Rac1 complex
Class: protein binding
Keywords: Protein binding
Deposited on 2015-03-12, released 2015-07-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-02-26, with a file datestamp of 2020-02-21.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 1 protein
    Species: Homo sapiens [TaxId:9606]
    Gene: PREX1, KIAA1415
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: ras-related c3 botulinum toxin substrate 1
    Species: Homo sapiens [TaxId:9606]
    Gene: RAC1, TC25, MIG5
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63000 (2-End)
      • engineered mutation (13)
    Domains in SCOPe 2.08: d4yonb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4yonB (B:)
    gsmqaikcvvvgdvavgktcllisyttnafpgeyiptvfdnysanvmvdgkpvnlglwdt
    agqedydrlrplsypqtdvflicfslvspasfenvrakwypevrhhcpntpiilvgtkld
    lrddkdtieklkekkltpitypqglamakeigavkylecsaltqrglktvfdeairavl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4yonB (B:)
    mqaikcvvvgdvavgktcllisyttnafpgeyiptvfdnysanvmvdgkpvnlglwdtag
    qedydrlrplsypqtdvflicfslvspasfenvrakwypevrhhcpntpiilvgtkldlr
    ddkdtieklkekkltpitypqglamakeigavkylecsaltqrglktvfdeairav