PDB entry 4yom

View 4yom on RCSB PDB site
Description: Structure of SAD kinase
Class: transferase
Keywords: kinase domain, UBA domain, KA1 domain, TRANSFERASE
Deposited on 2015-03-12, released 2015-12-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-12-16, with a file datestamp of 2015-12-11.
Experiment type: XRAY
Resolution: 2.49 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine/threonine-protein kinase BRSK2
    Species: Mus musculus [TaxId:10090]
    Gene: Brsk2
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Serine/threonine-protein kinase BRSK2
    Species: Mus musculus [TaxId:10090]
    Gene: Brsk2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q69Z98 (Start-341)
      • expression tag (342-343)
    Domains in SCOPe 2.06: d4yomb1, d4yomb2
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4yomB (B:)
    mtstgkdgggaqhaqyvgpyrlektlgkgqtglvklgihcvtcqkvaikivnreklsesv
    lmkvereiailkliehphvlklhdvyenkkylylvlehvsggelfdylvkkgrltpkear
    kffrqiisaldfchshsichrdlkpenllldernniriadfgmaslqvgdslletscgsp
    hyacpevirgekydgrkadvwscgvilfallvgalpfdddnlrqllekvkrgvfhmphfi
    ppdcqsllrgmievdaarrltlehiqkhiwyiggknepepeqpiprkvqirslpsledid
    pdvldsmhslgcfrdrnkllqdllseeenqekmiyfllldrklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4yomB (B:)
    haqyvgpyrlektlgkgqtglvklgihcvtcqkvaikivnreklsesvlmkvereiailk
    liehphvlklhdvyenkkylylvlehvsggelfdylvkkgrltpkearkffrqiisaldf
    chshsichrdlkpenllldernniriadfgmaslqvgdslletscgsphyacpevirgek
    ydgrkadvwscgvilfallvgalpfdddnlrqllekvkrgvfhmphfippdcqsllrgmi
    evdaarrltlehiqkhiwyiggknkvqirslpsledidpdvldsmhslgcfrdrnkllqd
    llseeenqekmiyfllldrkle