PDB entry 4yol

View 4yol on RCSB PDB site
Description: Human fibroblast growth factor-1 C16S/A66C/C117A/P134A
Class: protein binding
Keywords: fibroblast growth factor-1, cysteine-free mutant, FGF-1, intramolecular disulfide, PROTEIN BINDING
Deposited on 2015-03-11, released 2016-03-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-03-16, with a file datestamp of 2016-03-11.
Experiment type: XRAY
Resolution: 1.97 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fibroblast growth factor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: FGF1, FGFA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05230
      • engineered mutation (22)
      • engineered mutation (72)
      • engineered mutation (123)
      • engineered mutation (140)
  • Chain 'B':
    Compound: fibroblast growth factor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: FGF1, FGFA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05230
      • engineered mutation (22)
      • engineered mutation (72)
      • engineered mutation (123)
      • engineered mutation (140)
  • Heterogens: FLC, IMD, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.06, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >4yolA (A:)
    mhhhhhhfnlppgnykkpkllyssngghflrilpdgtvdgtrdrsdqhiqlqlsaesvge
    vyikstetgqylcmdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkk
    ngsakrgprthygqkailflalpvssd
    

    Sequence, based on observed residues (ATOM records):
    >4yolA (A:)
    hhhhhfnlppgnykkpkllyssngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevy
    ikstetgqylcmdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkng
    sakrgprthygqkailflalpvs
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >4yolB (B:)
    mhhhhhhfnlppgnykkpkllyssngghflrilpdgtvdgtrdrsdqhiqlqlsaesvge
    vyikstetgqylcmdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkk
    ngsakrgprthygqkailflalpvssd
    

    Sequence, based on observed residues (ATOM records):
    >4yolB (B:)
    hhhhhfnlppgnykkpkllyssngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevy
    ikstetgqylcmdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkng
    sakrgprthygqkailflalpvs