PDB entry 4ynz

View 4ynz on RCSB PDB site
Description: Structure of the N-terminal domain of SAD
Class: transferase
Keywords: kinase domain, UBA domain, TRANSFERASE
Deposited on 2015-03-11, released 2015-12-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-12-16, with a file datestamp of 2015-12-11.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine/threonine-protein kinase BRSK2
    Species: Mus musculus [TaxId:10090]
    Gene: Brsk2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q69Z98 (6-333)
      • expression tag (0-5)
      • expression tag (334)
    Domains in SCOPe 2.06: d4ynza1, d4ynza2, d4ynza3
  • Chain 'B':
    Compound: Serine/threonine-protein kinase BRSK2
    Species: Mus musculus [TaxId:10090]
    Gene: Brsk2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q69Z98 (6-333)
      • expression tag (0-5)
      • expression tag (334)
    Domains in SCOPe 2.06: d4ynzb1, d4ynzb2, d4ynzb3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ynzA (A:)
    gplgsmqyvgpyrlektlgkgqtglvklgihcvtcqkvaikivnreklsesvlmkverei
    ailkliehphvlklhdvyenkkylylvlehvsggelfdylvkkgrltpkearkffrqiis
    aldfchshsichrdlkpenllldernniriadfgmaslqvgdslletscgsphyacpevi
    rgekydgrkadvwscgvilfallvgalpfdddnlrqllekvkrgvfhmphfippdcqsll
    rgmievdaarrltlehiqkhiwyiggknepepeqpiprkvqirslpsledidpdvldsmh
    slgcfrdrnkllqdllseeenqekmiyfllldrklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ynzA (A:)
    gplgsmqyvgpyrlektlgkgqtglvklgihcvtcqkvaikivnreklsesvlmkverei
    ailkliehphvlklhdvyenkkylylvlehvsggelfdylvkkgrltpkearkffrqiis
    aldfchshsichrdlkpenllldernniriadfgmaslqsphyacpevirgekydgrkad
    vwscgvilfallvgalpfdddnlrqllekvkrgvfhmphfippdcqsllrgmievdaarr
    ltlehiqkhiwyigprkvqirslpsledidpdvldsmhslgcfrdrnkllqdllseeenq
    ekmiyfllldrkl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4ynzB (B:)
    gplgsmqyvgpyrlektlgkgqtglvklgihcvtcqkvaikivnreklsesvlmkverei
    ailkliehphvlklhdvyenkkylylvlehvsggelfdylvkkgrltpkearkffrqiis
    aldfchshsichrdlkpenllldernniriadfgmaslqvgdslletscgsphyacpevi
    rgekydgrkadvwscgvilfallvgalpfdddnlrqllekvkrgvfhmphfippdcqsll
    rgmievdaarrltlehiqkhiwyiggknepepeqpiprkvqirslpsledidpdvldsmh
    slgcfrdrnkllqdllseeenqekmiyfllldrklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ynzB (B:)
    gplgsmqyvgpyrlektlgkgqtglvklgihcvtcqkvaikivnreklsesvlmkverei
    ailkliehphvlklhdvyenkkylylvlehvsggelfdylvkkgrltpkearkffrqiis
    aldfchshsichrdlkpenllldernniriadfgmaslsphyacpevirgekydgrkadv
    wscgvilfallvgalpfdddnlrqllekvkrgvfhmphfippdcqsllrgmievdaarrl
    tlehiqkhiwyiggknepepeqpiprkvqirslpsledidpdvldsmhslgcfrdrnkll
    qdllseeenqekmiyfllldrkl