PDB entry 4yn5

View 4yn5 on RCSB PDB site
Description: Catalytic domain of Bacillus sp. JAMB-750 GH26 Endo-beta-1,4-mannanase
Class: hydrolase
Keywords: Glycoside hydrolase, HYDROLASE
Deposited on 2015-03-09, released 2016-03-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-03-09, with a file datestamp of 2016-03-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mannan endo-1,4-beta-mannosidase
    Species: Bacillus sp. JAMB750 [TaxId:253629]
    Gene: Man26A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4yn5a_
  • Heterogens: CAC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4yn5A (A:)
    mrgshhhhhhgmasmtggqqmgrdlyddddkdrwgseskipkdsegqsfklvdsnastlt
    kslyaylqdtsgrqilfghqhavdegltltnsgdrvgstqsevknavgdypaifgwdtls
    ldgyekpgneknsqaqnranvvqsmrtvhelggiialsmhpenfvtgnqyndtsgdvvkn
    ilpdgshhevfnawldniaafaheltdqstgelipvifrpfheqnggwfwwgaqtttase
    ykalyrytvdylrdvkgvnnflyafspnapfdgnltqylrtypgdqyvdifgldqydnka
    nagqatflngltqdlamiskladekgkiaafteygyspqgfnetgnylqwytavleaikk
    dpnasriaymqtwanfgyptnmfvpyrdvngnlggdhellpnfvefyeddyaaflteasg
    wnlyqdistieqepfmhivtpt
    

    Sequence, based on observed residues (ATOM records): (download)
    >4yn5A (A:)
    ipkdsegqsfklvdsnastltkslyaylqdtsgrqilfghqhavdegltltnsgdrvgst
    qsevknavgdypaifgwdtlsldgyekpgneknsqaqnranvvqsmrtvhelggiialsm
    hpenfvtgnqyndtsgdvvknilpdgshhevfnawldniaafaheltdqstgelipvifr
    pfheqnggwfwwgaqtttaseykalyrytvdylrdvkgvnnflyafspnapfdgnltqyl
    rtypgdqyvdifgldqydnkanagqatflngltqdlamiskladekgkiaafteygyspq
    gfnetgnylqwytavleaikkdpnasriaymqtwanfgyptnmfvpyrdvngnlggdhel
    lpnfvefyeddyaaflteasgwnlyqdisti