PDB entry 4ymy

View 4ymy on RCSB PDB site
Description: Crystal structure of mutant nitrobindin M75A/H76L/Q96C/M148L/H158A (NB11) from Arabidopsis thaliana
Class: transport protein
Keywords: beta-barrel, intracellular transport, hydrophobic ligand, Cytoplasm, TRANSPORT PROTEIN
Deposited on 2015-03-08, released 2015-12-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-12-30, with a file datestamp of 2015-12-24.
Experiment type: XRAY
Resolution: 1 Å
R-factor: N/A
AEROSPACI score: 0.82 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: UPF0678 fatty acid-binding protein-like protein At1g79260
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At1g79260, YUP8H12R.14
    Database cross-references and differences (RAF-indexed):
    • Uniprot O64527 (Start-173)
      • engineered mutation (82-83)
      • engineered mutation (103)
      • engineered mutation (155)
      • engineered mutation (165)
    Domains in SCOPe 2.07: d4ymya_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ymyA (A:)
    mwshpqfeknqlqqlqnpgesppvhpfvaplsyllgtwrgqgegeyptipsfrygeeirf
    shsgkpviaytqktwklesgapalaesgyfrprpdgsievviacstglvevqkgtynvde
    qsiklksdlvgnaskvkeisrefelvdgklsyvvrlstttnplqpalkaildkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ymyA (A:)
    ppvhpfvaplsyllgtwrgqgegeyptipsfrygeeirfshsgkpviaytqktwklesga
    palaesgyfrprpdgsievviacstglvevqkgtynvdeqsiklksdlvgnaskvkeisr
    efelvdgklsyvvrlstttnplqpalkaildkl