PDB entry 4ymu
View 4ymu on RCSB PDB site
Description: Crystal structure of an amino acid ABC transporter complex with arginines and ATPs
Class: protein binding/transport protein
Keywords: ABC transporter, two binding sites, substrate specificity, membrane protein complex, PROTEIN BINDING-TRANSPORT PROTEIN complex
Deposited on
2015-03-07, released
2015-04-22
The last revision prior to the SCOPe 2.06 freeze date was dated
2015-05-06, with a file datestamp of
2015-05-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: ABC-type polar amino acid transport system, ATPase component
Species: Caldanaerobacter subterraneus subsp. tengcongensis MB4 [TaxId:273068]
Gene: GlnQ, TTE0514
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d4ymua_ - Chain 'C':
Compound: ABC-type amino acid transport system, permease component
Species: Caldanaerobacter subterraneus subsp. tengcongensis MB4 [TaxId:273068]
Gene: ArtM, TTE0513
Database cross-references and differences (RAF-indexed):
- Chain 'D':
Compound: ABC-type amino acid transport system, permease component
Species: Caldanaerobacter subterraneus subsp. tengcongensis MB4 [TaxId:273068]
Gene: ArtM, TTE0513
Database cross-references and differences (RAF-indexed):
- Chain 'J':
Compound: ABC-type polar amino acid transport system, ATPase component
Species: Caldanaerobacter subterraneus subsp. tengcongensis MB4 [TaxId:273068]
Gene: GlnQ, TTE0514
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d4ymuj_ - Heterogens: ATP, MG, ARG
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>4ymuA (A:)
mifvndvyknfgslevlkgvtlkvnkgevvviigpsgsgkstllrcinlleeptkgevfi
dgvkinngkvninkvrqkvgmvfqhfnlfphltaienitlapvkvkkmnkkeaeelavdl
lakvglldkkdqypiklsggqkqrlaiaralamqpevmlfdeptsaldpemvkevlnvmk
qlanegmtmvvvthemgfarevgdrvifmddgviveegtpeeifyraknertreflskil
- Chain 'C':
No sequence available.
- Chain 'D':
No sequence available.
- Chain 'J':
Sequence; same for both SEQRES and ATOM records: (download)
>4ymuJ (J:)
mifvndvyknfgslevlkgvtlkvnkgevvviigpsgsgkstllrcinlleeptkgevfi
dgvkinngkvninkvrqkvgmvfqhfnlfphltaienitlapvkvkkmnkkeaeelavdl
lakvglldkkdqypiklsggqkqrlaiaralamqpevmlfdeptsaldpemvkevlnvmk
qlanegmtmvvvthemgfarevgdrvifmddgviveegtpeeifyraknertreflskil