PDB entry 4ym1

View 4ym1 on RCSB PDB site
Description: Crystal structure of the human galectin-4 C-terminal carbohydrate recognition domain in complex with 2'-fucosyllactose
Class: sugar binding protein
Keywords: galectin, lectin, carbohydrate binding protein, H-antigen, carbohydrate recognition, beta sandwich, SUGAR BINDING PROTEIN
Deposited on 2015-03-06, released 2015-07-01
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-09-09, with a file datestamp of 2015-09-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Galectin-4
    Species: Homo sapiens [TaxId:9606]
    Gene: LGALS4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4ym1a_
  • Chain 'B':
    Compound: Galectin-4
    Species: Homo sapiens [TaxId:9606]
    Gene: LGALS4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4ym1b_
  • Chain 'C':
    Compound: Galectin-4
    Species: Homo sapiens [TaxId:9606]
    Gene: LGALS4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4ym1c_
  • Chain 'D':
    Compound: Galectin-4
    Species: Homo sapiens [TaxId:9606]
    Gene: LGALS4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4ym1d_
  • Heterogens: LAT, FUC, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ym1A (A:)
    hchqqlnslptmegpptfnppvpyfgrlqggltarrtiiikgyvpptgksfainfkvgss
    gdialhinprmgngtvvrnsllngswgseekkithnpfgpgqffdlsircgldrfkvyan
    gqhlfdfahrlsafqrvdtleiqgdvtlsyvqi
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ym1A (A:)
    ptfnppvpyfgrlqggltarrtiiikgyvpptgksfainfkvgssgdialhinprmgngt
    vvrnsllngswgseekkithnpfgpgqffdlsircgldrfkvyangqhlfdfahrlsafq
    rvdtleiqgdvtlsyvqi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4ym1B (B:)
    hchqqlnslptmegpptfnppvpyfgrlqggltarrtiiikgyvpptgksfainfkvgss
    gdialhinprmgngtvvrnsllngswgseekkithnpfgpgqffdlsircgldrfkvyan
    gqhlfdfahrlsafqrvdtleiqgdvtlsyvqi
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ym1B (B:)
    ptfnppvpyfgrlqggltarrtiiikgyvpptgksfainfkvgssgdialhinprmgngt
    vvrnsllngswgseekkithnpfgpgqffdlsircgldrfkvyangqhlfdfahrlsafq
    rvdtleiqgdvtlsyvqi
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4ym1C (C:)
    hchqqlnslptmegpptfnppvpyfgrlqggltarrtiiikgyvpptgksfainfkvgss
    gdialhinprmgngtvvrnsllngswgseekkithnpfgpgqffdlsircgldrfkvyan
    gqhlfdfahrlsafqrvdtleiqgdvtlsyvqi
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ym1C (C:)
    gpptfnppvpyfgrlqggltarrtiiikgyvpptgksfainfkvgssgdialhinprmgn
    gtvvrnsllngswgseekkithnpfgpgqffdlsircgldrfkvyangqhlfdfahrlsa
    fqrvdtleiqgdvtlsyvqi
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4ym1D (D:)
    hchqqlnslptmegpptfnppvpyfgrlqggltarrtiiikgyvpptgksfainfkvgss
    gdialhinprmgngtvvrnsllngswgseekkithnpfgpgqffdlsircgldrfkvyan
    gqhlfdfahrlsafqrvdtleiqgdvtlsyvqi
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ym1D (D:)
    gpptfnppvpyfgrlqggltarrtiiikgyvpptgksfainfkvgssgdialhinprmgn
    gtvvrnsllngswgseekkithnpfgpgqffdlsircgldrfkvyangqhlfdfahrlsa
    fqrvdtleiqgdvtlsyvqi