PDB entry 4yld

View 4yld on RCSB PDB site
Description: The crystal structure of Sclerotium Rolfsii lectin variant 1 (SSR1)
Class: sugar binding protein
Keywords: Lectin, carbohydrate-binding specificity, sugar binding protein
Deposited on 2015-03-05, released 2015-07-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-07-01, with a file datestamp of 2015-06-26.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sclerotium Rolfsii lectin variant 1 (SSR1)
    Species: Athelia rolfsii [TaxId:39291]
    Database cross-references and differences (RAF-indexed):
    • PDB 4YLD (0-140)
    Domains in SCOPe 2.07: d4ylda_
  • Chain 'B':
    Compound: Sclerotium Rolfsii lectin variant 1 (SSR1)
    Species: Athelia rolfsii [TaxId:39291]
    Database cross-references and differences (RAF-indexed):
    • PDB 4YLD (0-140)
    Domains in SCOPe 2.07: d4yldb_
  • Heterogens: MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4yldA (A:)
    tykitvrvyqtnpdaffhpvektvwkyanggtwtitddqhvltmggsgtsgtlrfhadng
    esftatfgvhnykrwcdivtnlaadetgmvinqqyysqknreearerqlsnyqvknakgr
    nfqivyteaegndlhanliig
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4yldB (B:)
    tykitvrvyqtnpdaffhpvektvwkyanggtwtitddqhvltmggsgtsgtlrfhadng
    esftatfgvhnykrwcdivtnlaadetgmvinqqyysqknreearerqlsnyqvknakgr
    nfqivyteaegndlhanliig