PDB entry 4yl4

View 4yl4 on RCSB PDB site
Description: 1.1 Angstrom resolution X-ray Crystallographic Structure of Psudoazurin
Class: electron transport
Keywords: Blue Copper Protein, Electron Transfer, ELECTRON TRANSPORT
Deposited on 2015-03-05, released 2016-03-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-01-29, with a file datestamp of 2020-01-24.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: N/A
AEROSPACI score: 0.72 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pseudoazurin
    Species: Achromobacter cycloclastes [TaxId:223]
    Gene: BCP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4yl4a_
  • Heterogens: CU, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4yl4A (A:)
adfevhmlnkgkdgamvfepaslkvapgdtvtfiptdkghnvetikgmipdgaeafkski
nenykvtftapgvygvkctphygmgmvgvvqvgdapanleavkgaknpkkaqerldaala
algn