PDB entry 4ykk

View 4ykk on RCSB PDB site
Description: Mnemiopsis leidyi ML032222a iGluR LBD D-serine complex
Class: membrane protein
Keywords: Membrane Protein, Glutamate Receptor, Ion Channel
Deposited on 2015-03-04, released 2015-10-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-11-18, with a file datestamp of 2015-11-13.
Experiment type: XRAY
Resolution: 1.38 Å
R-factor: N/A
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ML032222a iGluR
    Species: Mnemiopsis leidyi [TaxId:27923]
    Gene: ML032222a
    Database cross-references and differences (RAF-indexed):
    • PDB 4YKK
    Domains in SCOPe 2.07: d4ykka_
  • Chain 'B':
    Compound: ML032222a iGluR
    Species: Mnemiopsis leidyi [TaxId:27923]
    Gene: ML032222a
    Database cross-references and differences (RAF-indexed):
    • PDB 4YKK (0-End)
    Domains in SCOPe 2.07: d4ykkb_
  • Heterogens: MG, DSN, GLY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ykkA (A:)
    gsknligrhlrlgsveeqpfmffategcegndcwsgmvndmvvklsedlgftyeyiqpdd
    rkfgalnkttnewngmirdllddktdmiaidlstnsarksaidysfpfmdagikavvkge
    gttlnqvlelldqdkykwgvigsrhpetllkthrdsrysrlvdegvelkdlnhaietlrg
    glfvfidegpvlahnlisdcdvfsvgeefqsfeyafglpkdspykslidshllkfreegf
    idilwekwssgnsvcs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ykkA (A:)
    nligrhlrlgsveeqpfmffategcegndcwsgmvndmvvklsedlgftyeyiqpddrkf
    galnkttnewngmirdllddktdmiaidlstnsarksaidysfpfmdagikavvkgegtt
    lnqvlelldqdkykwgvigsrhpetllkthrdsrysrlvdegvelkdlnhaietlrgglf
    vfidegpvlahnlisdcdvfsvgeefqsfeyafglpkdspykslidshllkfreegfidi
    lwekwss
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4ykkB (B:)
    gsknligrhlrlgsveeqpfmffategcegndcwsgmvndmvvklsedlgftyeyiqpdd
    rkfgalnkttnewngmirdllddktdmiaidlstnsarksaidysfpfmdagikavvkge
    gttlnqvlelldqdkykwgvigsrhpetllkthrdsrysrlvdegvelkdlnhaietlrg
    glfvfidegpvlahnlisdcdvfsvgeefqsfeyafglpkdspykslidshllkfreegf
    idilwekwssgnsvcs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ykkB (B:)
    gsknligrhlrlgsveeqpfmffategcegndcwsgmvndmvvklsedlgftyeyiqpdd
    rkfgalnkttnewngmirdllddktdmiaidlstnsarksaidysfpfmdagikavvkge
    gttlnqvlelldqdkykwgvigsrhpetllkthrdsrysrlvdegvelkdlnhaietlrg
    glfvfidegpvlahnlisdcdvfsvgeefqsfeyafglpkdspykslidshllkfreegf
    idilwekwssgnsvc